Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024053 (Emilin2)
Chromosomal location
Chr 17: 71601516 - 71660326 (-)
Description
elastin microfibril interfacer 2 Gene [Source:MGI Symbol;Acc:MGI:2389136]
RefSeq_dna
NM_145158 
RefSeq_peptide
NP_660140.1 
UniGene
Mm.23462 Mm.416146 
MGI
MGI:2389136 
Uniprot/SWISSPROT
Q8K482 
Uniprot/SPTREMBL
Q3TBC8 Q3TBD3 Q3TCC1 Q3TDB5 Q3TDP9 Q3U1J9 
Human Ortholog
ENSG00000132205 (EMILIN2)
Omim not available
UniTrap UNI33232
Vector Insertion
Chr 17: 71605663 - 71624628
Public Clones IST11824C4 (tigm) IST11078F12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024849
Sequence
GTCATTGAGGGACCGCGGAGCGGCCAGTGCGGAGGCGTGGGGACGAAGAGCCAGAGGGGCCGCCGAGCGCCCGAGCCCGCTGCCGGTTCCCGCGGCCCCG

CCGCCTGCAGCCTTGTGGGGCTCAAGATGTGTCAGGAGACCCCGCCCCGACCCCGAGCACCCAGTCGCTGGACGCCGGCCCTGCTGGCCCTGCTGGCCCT

GGGCGGCGCGGGACTGTGCCACGCGAGCTCGCAGCCTGGGTACCACGCGAGGCCCAGTGCCAGGAACAA AAACTGGTGCGCCTACATCGTGAATAAGAA

CGTGAGCTGCACGGTACAGGAGGGAAGCGAGAGTTTTATTCAAGCTCAGTACAACTGTCCCTGGAACCAGATGCCCTGTCCATCCGCCCTGGT GTATCG

GGTAAACTTTAGACCCAGATTTGTCACTAGATACAAGATAGTGACACAGTTGGAATGGAGATGCTGTCCTGGCTTTAGAGGACCAGACTGCCAAGAAGGT

CCCAAAGACCACATGAAGACCCCCCGGCCCCCATCAGCTCGACCAAAAAACAACCTGAAGAAAGCCACAG - UNI33232 - ATACAGATCCAAGCCA

AGTTTCTCAGCCTAAGAAAACGTTGTCCCCAACAAATGCAGTGGAACCAGGTCAGGTTGCAGATGCAAAGCAAGGCCCTCCGGAACTTCAGCAATCCAAA

GTCCAGGTGCTGGAGGAGAAGGTCGTCCGACTCACCAGGATGGTGCTGGATCTCCAGTCCACCGTGGTAGGCCTGAAGGAGAACCTCAAACACACCATTC

AAGATGATGGCAGAAAAGAGCCAGACTCCTGGCTCGGTCCCCTGCACCCACAGCCAACGCCTGACAGCCCCCTTGCGGGGGACGCAGAGCCGAGCCAGCT

TCCCGGAATCCCCAGCAGCAAGGAATCTGGTATGAAGGACATCAAGTCTGAGTTGGCTGAGGTCAAAGACACACTGAAGACCAAGAGTGACAAGCTAGAA

GAGCTGGACGGGAAGGTGAAGGGCTATGAAGGACAGCTCAAGCAGCTGCAGGAGGCGGCTCAGGGTCCCACGGTCACCATGACAACCAATGAGCTGTACC

AAGCCTATGTGGATAGCAAGATCGATGCCCTGAGGGAGGAGCTCATGGAAGGCATGGACCGGAAGCTGGCTGACCTGAAGAATACGTGCGAGTACAAGCT

GGTGGGGCTCCAGCAGCAGTGTGATGACTACGGCAGCAGCTACCTCGGAGTGATAGAGCTGATCGGGGAGAAGGAGGCGAGCCTGAAAAAAGACATTGCT

GACCTGCGAGCCCAGCTGCAGGATCCTGTAGCCCAACCAAGCTGTTGCAATGGTCAAAAGAGCAGCGATTTCGGCCCACAGATCAAGGCGCTAGACCAGA

AAATCGAGAGAGTTGCCGAGGCCACCAGGATGCTGAATGGACGGCTGGACAATGAGTTCGACCGCCTCTCCGTTCCAGAGCCAGACGCAGACTTTGATGC

GAGATGGACCGAGCTCGACGCAAGGATCAATGTGACGGAGAAGAACGCAGAGGAGCATTGCTTTTACATTGAGGAGACCCTGCGGGGGACCATCAACGGC

GAAGTGGATGACTTGAGGAAGCTTCTGAATGAGAAGATCCACTCCCTGGAAGACCGTCTGGGAATTGTTCTGCAAGCGGCTAACAGCTCAGACGTGGAGT

TGACACCCATGGGCCCAGCCTTGCCAGAGCAGCCAGGGGCAGAGAATGAGCAGGTCCTAATGGAGTTGAGCCGCCTGAAGGACAAAGTTCAAGTGGTTGA

GGACTTCTGCCTGCAGAGCTTGCCCCACGGGATAGATGGAGCTTTGCCTAGTGTAGAGGACCTCACGCATGTCAGCCTGAGCCTTTTAGAATCCCTCAAT

GATACGATGCACAGGCAGTTCCAAGAAACGAGTCACAGCATCCAGAAACTCCAAGAGGACGTCAATGCCCTCCATTCTCAACTGAATCACTCCGAATGTA

CGGGGACTTACTTGCAGAACGGAGTGAGCGACAGCCGAACAGGTGACAGCATGGAAGCAAGTGGGTTTACTAAGACAGGGGAGCAAGAGAGGACAGTGGG

GACTGTCCCGTCTCCTGGGACCCCCGCGGCTCCATGCTGTGGTCAGCTGGAGGAGCGCTGGCAGAAGCTGCAGAACCAAATGTTGGCTGAGCTAGACACG

TGTAAGGAGAGTGCTCACGGGGTTCAGAGTGGGGTGTCTGCGATCGAGGGCAGGGTGTTCCAGCTGGAGCAGACATGCAGAAGGCTGGATACCATCTCAG

GGAGTCTGCAGAGGATCAAGGAGGGGCTCGGTAAGCATGTGGGCAGCTTGTGGAACTGCATCCGGCAGATGAACGGGACGCTCAAATCGCACTCCAGAGA

CATCTCTGGCCTCAAGAATTCTGTGCAGCAATTCTATAGCCATGTTTTCCAGATTTCTACCGACTTGCAAGATCTGGTCAAGTTTCAGCCATCAGCAA -

 UNI33232 - CAGAGGAACCCTCAGAAGCAACCGAGGGACCGTCTGGGAAGACTCCCCTAGAATCCACCAGACCTTCAGAGGAGGCCCCCACTGAACC

ACCCCGGCTGACCCCACTGCCAGAAGACCCTGCAGGACCACCACAGACAGGCCAGCAGCCAGTATTGCCCCAGAGGCCCCTGCAGCCACCACCTTTGCCT

GCCTGGCCTGGTCGCACGGGGTTGCCCTTCTTGCCTGGCTCTAGTGGCGTCATCATGGAGACTGGAGAGGCGGGGCCTCCAGGCAGGATGGGCGTGTCCG

GAAGGGGCCTGCCTCGGGGAGTGGATGGCCAGATGGGGCAGGGGCCCATTCATAGCTCGGAAGGCTATGCAGGGGCACCAG - UNI33232 - GCTAC

CCCAAGTCACCTCCTGTAACCACCCCAG GGGTGCCGCTGCCCACTCTGGTGTCCTTTTCAGCCGGTCTTACCCAGAAGCCTTTTCCCAGCGATGGAGGC

GTTGTTCTCTTCAATAAGGTGCTGGTGAACGATGGGGATGTATACAACCCCAACACTG GGATCTTCACCGCACCATACGACGGGCGCTACTTGATCACA

GCCACCCTCACCCCTGAGAGAGACACCTATGTGGAAGCCGTCCTGTCTGTCTCCAACGCCAGTGTTGCCCAGCTGCACACGGCTGGGTACAGGAGAGAGT

TCCTGGAATACCATCGTCCCCCTGGGGCTGTGCATACCTGTGGGGGCCCGGGGGCCTTCCACCTCATTGTGCACTTGAAGGCAGGAGATGGAGTCAATGT

TGTGGTGACTGGGGGCAGACTGGCTCACACAGACTTTGATGAAATGTACTCCACCTTCAGTGGTGTTTTCTTGTACCCTTTCCTTTCTCACCTCTAGGGA

GACCAGGAAGGGAAGAAAGGCTGTGAAAACTCCAAAGCTTTAATATATTTGGTTTATGTAACTGGAGCACTGATCTAGCTTGCTGCACACACTCTGCCTG

CCCCCAGGATAAAAGCCTGCCATCCCTCGTTTCCAGACAGCTGTGGAAGTGACACATGGTTACTTCTGTCACTGGACAACCAGAAGACTCGTTATGTCCC

CTTGGCTGGAAGCTGGCTTCTCCTGTGCCGCCTATAAGCCAGCTCTGCTCGAAGTTCTTGGGTTGAATCTACTTGGTGCTGTTCCGACTGGCCTGGGCCT

GATGCAGCTGGAAGACACTGTAGCGGATGCGCCTCTCTACACTGCACGTAGAAGATTTAAACACTGAAGTGCTTATGTGGCCTGGACCCAGAGAGTTTAA

CATGGGCTGTTGTTCCACACTTGGTTGCTGTTACCGTCTGGTACTGATCTCTGTTCCCCTGGGCCCTGCTACCAAGGTGGATGTGAGAGACATTATTTAT

GAAACTTGCCAGGCTCCTTAAATGACATGTACAATATAAGTGCAAAGACAGGGAGCGTCAATAAAGATGTTGGAATC
Translation
MCQETPPRPRAPSRWTPALLALLALGGAGLCHASSQPGYHARPSARNK KNWCAYIVNKNVSCTVQEGSESFIQAQYNCPWNQMPCPSALV VYRVNFRP

RFVTRYKIVTQLEWRCCPGFRGPDCQEGPKDHMKTPRPPSARPKNNLKKATD - UNI33232 - DTDPSQVSQPKKTLSPTNAVEPGQVADAKQGPPE

LQQSKVQVLEEKVVRLTRMVLDLQSTVVGLKENLKHTIQDDGRKEPDSWLGPLHPQPTPDSPLAGDAEPSQLPGIPSSKESGMKDIKSELAEVKDTLKTK

SDKLEELDGKVKGYEGQLKQLQEAAQGPTVTMTTNELYQAYVDSKIDALREELMEGMDRKLADLKNTCEYKLVGLQQQCDDYGSSYLGVIELIGEKEASL

KKDIADLRAQLQDPVAQPSCCNGQKSSDFGPQIKALDQKIERVAEATRMLNGRLDNEFDRLSVPEPDADFDARWTELDARINVTEKNAEEHCFYIEETLR

GTINGEVDDLRKLLNEKIHSLEDRLGIVLQAANSSDVELTPMGPALPEQPGAENEQVLMELSRLKDKVQVVEDFCLQSLPHGIDGALPSVEDLTHVSLSL

LESLNDTMHRQFQETSHSIQKLQEDVNALHSQLNHSECTGTYLQNGVSDSRTGDSMEASGFTKTGEQERTVGTVPSPGTPAAPCCGQLEERWQKLQNQML

AELDTCKESAHGVQSGVSAIEGRVFQLEQTCRRLDTISGSLQRIKEGLGKHVGSLWNCIRQMNGTLKSHSRDISGLKNSVQQFYSHVFQISTDLQDLVKF

QPSAT - UNI33232 - TEEPSEATEGPSGKTPLESTRPSEEAPTEPPRLTPLPEDPAGPPQTGQQPVLPQRPLQPPPLPAWPGRTGLPFLPGSSGVI

METGEAGPPGRMGVSGRGLPRGVDGQMGQGPIHSSEGYAGAPG - UNI33232 - GYPKSPPVTTPG GVPLPTLVSFSAGLTQKPFPSDGGVVLFNK

VLVNDGDVYNPNTG GIFTAPYDGRYLITATLTPERDTYVEAVLSVSNASVAQLHTAGYRREFLEYHRPPGAVHTCGGPGAFHLIVHLKAGDGVNVVVTG

GRLAHTDFDEMYSTFSGVFLYPFLSHL

For any suggestions or comments, please send an email to unitrap@crg.es