Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024069 (Slc30a6)
Chromosomal location
Chr 17: 74794972 - 74823569 (+)
Description
solute carrier family 30 (zinc transporter), member 6 Gene [Source:MGI Symbol;Acc:MGI:2386741]
RefSeq_dna
NM_144798 
RefSeq_peptide
NP_659047.2 
UniGene
Mm.243943 Mm.412961 
MGI
MGI:2386741 
Uniprot/SWISSPROT
Q8BJM5 
Human Ortholog
ENSG00000152683 (SLC30A6)
Omim not available
UniTrap UNI16210
Vector Insertion
Chr 17: 74795009 - 74801251
Public Clones (ggtc) 5SE223C04 (ggtc) 3SE223C04 (ggtc) IST11013B8 (tigm) IST14523C5 (tigm)
IST15056E4 (tigm)
Private Clones OST465100 (lexicon) OST450404 (lexicon) OST170804 (lexicon) OST34406 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4673
Vector Insertion
Chr 17: 74801339 - 74803343
Public Clones AF0821 (sanger) AF0052 (sanger)
Private Clones OST428401 (lexicon) OST417240 (lexicon) OST402002 (lexicon) OST377662 (lexicon)
OST207989 (lexicon) OST200501 (lexicon) OST133834 (lexicon) OST68890 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9458
Vector Insertion
Chr 17: 74803429 - 74805024
Public Clones RRD082 (baygenomics)
Private Clones OST91016 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20060
Vector Insertion
Chr 17: 74806627 - 74808185
Public Clones not available
Private Clones OST374099 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22627
Vector Insertion
Chr 17: 74812067 - 74814959
Public Clones not available
Private Clones OST289680 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37004
Vector Insertion
Chr 17: 74815063 - 74817959
Public Clones (ggtc) CMHD-GT_535H12-5S (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37333
Vector Insertion
Chr 17: 74818008 - 74818871
Public Clones CMHD-GT_425D6-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4277
Vector Insertion
Chr 17: 74818941 - 74822356
Public Clones AM0285 (sanger) AH0442 (sanger) AM0291 (sanger) AM0292 (sanger)
XB487 (baygenomics) RRM224 (baygenomics) CMHD-GT_405G2-3 (cmhd) CMHD-GT_422A10-3 (cmhd)
CMHD-GT_535H12-3 (cmhd) IST14956G3 (tigm)
Private Clones OST184590 (lexicon) OST25363 (lexicon) OST16879 (lexicon) OST5625 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024870
Sequence
GCGTCTTCCGGCGGGAGCTGTACGGCTCCTTACCATG - UNI16210 - GGGACGATTCATCTCTTTCGAAAGCCACAGAGATCTTTTTTTGGAAAGT

TACTACAGGAATTTAGACTTGTCGCAGCTGACCGGAGG - UNI4673 - TCCTGGAAGATCCTTCTGTTCGGTGCAATCAACGTGCTGTGCACTGGCT

TCCTGCTCATGTGGTGCAGCTCCACCAACAGCATCG - UNI9458 - CATTAACTGCCTATACTTACCTCACCATCTTTGATCTCTTTAG TTTAATA

ACATGTTTAATAAGCTACTGGGTAATGATGAGGAAACCTAGCCCTGTCTATTCATTTGG - UNI20060 - GTTTGAAAGATTAGAAGTCCTGGCTGT

ATTTGCTTCTACTGTCTTGGCACAATTGGGAGCCCTCTTTATACTAAAAGAAAG TGCAGAACGCTTTTTGGAGCAGCCCGAGATACACAC GGGAAGAT

TGTTAGTTGGTACTTTTGTGGCCCTTTCTTTCAACCTGTTCACGATGCTTTCTATTCGGAATAAGCCTTTTGCTTACGTCTCTGAAG CTGCTAGTACGA

GCTGGCTTCAGGAGCACGTGGCAGACCTTAGCCGCAG CTTGTGTGGCCTTATCCCAGGACTCAGCAGTATCTTCCTGCCCCGCATGAATCCGTTTGTTC

TGATTGATCTTGCTGGGGCGTTTGCTCTGTGTATAACATACATGCTGATTGAGATTAA - UNI22627 - TAACTACTTTGCCGTGGACACTGCGTCA

GCCATTGCCATTGCCCTGATGACGTTTGGCACCATGTACCCCATGAGTGTGTACAGTGGGAAAGTGCTCCTCCAG ACAACACCACCTCATGTTATCGGT

CAGTTGGACAAACTGATTAGAGAG GTGTCTACCTTGGATGGGGTGCTAGAAGTCCGAAATGAACACTTTTGGACCCTTGGATTTGGCTCATTG - UNI

4277 - GCTGGGTCAGTGCATGTACGGATCCGACGAGATGCGAACGAACAAATGGTCCTTGCTCATGTGAGCAACAGGCTGTGCACGCTGGTGTCCACG

CTGACTGTTCAGATCTTCAAGGACGACTGGATTCGGCCTGCCTTATCCTCTGGGCCTGTTGCGCCCAACGTCCTAAACTTCTCAGACCATCACGTAATCC

CAATGCCTTTATTAAAGAACGTGGATGAGAGGACCCCCGTCACGTCAACCCCAGCCAAGCCCAGCAGCCCACCTCCGGAGTTTTCATTTAATACGCCTGG

GAAAAACGTGAGCCCGGTTATTCTTCTGAACACACAGACAAGGCCATATAGTTTGGGTCTTAATCGCGGACACACACCATACAGCAGCGTGTTCAGCCAA

GGACTCGCATTTCCAGGAGTTGGAGCAGGCCAGGGATTGAGGCCCACCTTCCCACATATACCAAGTAGATATGGAATCAACAGGATGGGGCAGCCAAGAC

CCTGACAGACTCTAACTTATTGTGATGGGGAATAGCGACTTCTTGCCTTCCAATGTATTTAGTAATCCAACTTGCATTGACTGTTCAACCACTTACATGT

CAGATTATTCCAGGCTTGTTCATATTTCATAAAACCTATAAACTATATTTTTGTAAAATGTTCTTGTGGCAGTGAGGTCTTTGGAAATGTCATGGGCATT

AGGTAGGCCTCCTTCAAAAAGTTTGGATATGAGCTGCTTTGTAGCAGCCTATGATGTGATAGTCTGGCCTCCAGCAGTAAAGCCATGTGCTGAGTGGATC

TGCATCTTACCAAAAATTCATAATTCCTTCAGTAGAATTTATAAACATACTTCATGTATGGTGCCCAACTAAGTAAATGAAACTTAGGTGTCCATTTGAA

AAGTAAATTCTCTTTTATAGCTTTTTAAAGCTTAATTGCTACATTTTTTGAGGCCCTCCCAAATCATTTGTTAAATAAAAAGTAACAGTTTCTATTGGAA

GTTGTGAGGTATATTCTACTATGTAGCACAATTTAATTATTACTGATCTTTTGAAACAGGTTTTGCTGCATAGATCAGGCTGGCTTCAAACCCATAATCC

TTCTGCCTCAGTCTCCCACATGCCAGGATTTAGGTTTTGAGCCACCATAGAAGTATGTCCTAAAATTTTAAGTAACAGGTTTTGAATAAAGAGTGTTTGG

CTTTTTTTTTTTTCCCATTT
Translation
M - UNI16210 - GTIHLFRKPQRSFFGKLLQEFRLVAADRR - UNI4673 - SWKILLFGAINVLCTGFLLMWCSSTNSIA - UNI9458 - A

LTAYTYLTIFDLFS SLITCLISYWVMMRKPSPVYSFG - UNI20060 - GFERLEVLAVFASTVLAQLGALFILKES SAERFLEQPEIHT TGRLL

VGTFVALSFNLFTMLSIRNKPFAYVSEA AASTSWLQEHVADLSRS SLCGLIPGLSSIFLPRMNPFVLIDLAGAFALCITYMLIEIN - UNI22627 

- NNYFAVDTASAIAIALMTFGTMYPMSVYSGKVLLQ TTPPHVIGQLDKLIRE VSTLDGVLEVRNEHFWTLGFGSL - UNI4277 - AGSVHVRIR

RDANEQMVLAHVSNRLCTLVSTLTVQIFKDDWIRPALSSGPVAPNVLNFSDHHVIPMPLLKNVDERTPVTSTPAKPSSPPPEFSFNTPGKNVSPVILLNT

QTRPYSLGLNRGHTPYSSVFSQGLAFPGVGAGQGLRPTFPHIPSRYGINRMGQPRP

For any suggestions or comments, please send an email to unitrap@crg.es