Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024081 (Cebpz)
Chromosomal location
Chr 17: 79319093 - 79336390 (-)
Description
CCAAT/enhancer binding protein zeta Gene [Source:MGI Symbol;Acc:MGI:109386]
RefSeq_dna
NM_001024806 
RefSeq_peptide
NP_001019977.1 
UniGene
Mm.24169 
MGI
MGI:109386 
Uniprot/SWISSPROT
P53569 
Uniprot/SPTREMBL
Q3UGK4 Q3UUZ3 
Human Ortholog
ENSG00000115816 (CEBPZ)
Omim not available
UniTrap UNI16402
Vector Insertion
Chr 17: 79335408 - 79336214
Public Clones not available
Private Clones OST461680 (lexicon) OST444504 (lexicon) OST57128 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024885
Sequence
ACTCGCGTGTCCAGCCCGCCATGTCGGCCGACCAGGAACCTGTGGCGTTCCTTGCCAAGCAGCCCTGGCGTCCCAAACAGGTGACAGAAGATCCGGATGA

GGAAGACGAGGAGGATGGCGATGAGGGCAAGAATGGCTTCTCCCTGGAGGAGGTGTTACGCCTCGGAGGCACAAAG - UNI16402 - CAAGATTACC

TTATGCTGGCTACTTTGGATGAAAATGAGGAAGTGGTGGATGGGGGCAAAAAGGGAACCATTGACGACCTTCAACAAGGTGAACTGGAGTCATTTATTCA

GAATCTGAATTTGGCCAAATACTCAAAGTCTTTGATTGAAGAAGATGAACCAGAGAAAAAGGAAAACACCAGCAAAAAAGAAGCAAAACTACTGAAGGTG

GAGAATAAAAAACAAAAAGCAACAGAAGGAAAAAAGACATCGGAAAAGAAGGTGAAAAATAAGACTGTACCAGAACAGCGTCCTGAGAGCTGTCCCGTCT

CCAAAGCAAAGAAAGATAAACAACCCGATGTGTTTGAATTTCTAGAGAGACAAACAATGTTACTCAGGCCTGGAGGCAAGTGGTACGACATGGAGTACAG

CGGTGAGTATTCCTTGGAGCTGCAGCCTCCAGATGTCGTGTCCAAGTACAAAGCCCTGGCCCAGAAGCTGTATGAGCACGAAGTCAGCTTATTCAAGAGT

AAGACAAACAATCAAAAGGGAGGCTCTTCCACCTGGATGAAGGCCATCGTGTCATCAGGGACACTAGCTGACAGGATGGCGGCCATGATCCTTCTAATCC

AGGATGATGCTGTCCACACTCTGCAGTTTGTAGAAACCCTGATGAGCCTTGTGAAAAAGAAGGGCAGCAAGCAGCAGTGCCTCATGGCGTTGGACACGTT

CAAGGAGTTGCTCATCACAGACCTTCTGCCAGACAGTCGGAAGCTCCGGGTTTTCAGCCAGCATCCTTTCCACAAACTGGAAGAGTTGTCCAGTGGCAAC

AAGGACTCGAGAGATAGAAGACTGATACTGTGGTATTATGAACACCAATTGAAACACTTGGTAGCAGAATTCGTCCAGGTCCTCGAGACTTTAAGTCATG

ATTCCTTGGTAACCACTAAAACGCGGGCCCTGGTAGCTGCCCATGAGCTGCTCTGTGATAAACCCGAGGAGGAAAAGGCTCTTCTTGTGCAGGTGATAAA

TAAGCTGGGAGATCCTCAGAACAGAATTGCTACGAAAGCCTCCCATCTGTTAGAAGTGTTACTTCGGAAGCATCCCAATATGAAAGGAGTTGTGTGTGCA

GAAATAGAAAGGCTACTCTTCCGCTCAAATATCAGCCCCAAAGCTCAGTATTATGCAATTTGCTTTCTAAACCAAATGGTCCTCTCCCATGAAGAAAGTG

AGTTGGCTAACAAATTAATTACTCTTTATTTTTGTTTCTTTCGGACTTGTATCAAGAAAAAAGACATTGAATCAAAAATGCTCAGTGCGATTTTAACAGG

GGTGAACAGAGCATACCCTTACTCCCAGATAGGTGACGACAAAGTGAGGGAGCAGGTGGACACTTTATTCAAAGTGTTGCATGTTGTAAATTTTAATACG

AGTGTGCAGGCTTTAATGCTACTTTTCCAAGTAATGAATTCTCAACAGACAATATCTGACCGATATTACACAGCTTTATACAG AAAGATGTTGGATCCA

GGCCTGACGACATGTTCCAAGCAAGCGATGTTTCTCAACCTGATCTACAAATCTTTGAAAGCTGACATCATGCTGCGCCGGGTGAAGGCGTTTGTGAAGA

GGTTGCTTCAGGTCACCTGCACACAGATGCCGCCATTCATTTGTGGAGCGTTGTATCTTGTGTCTGAGATCCTTAAAGCAAAACCAGATTTAAGAAGCCA

ACTAGATGATCATCCG GAGTCTGACGAAGAAAACTTCGTTGACGTGGGAGATGACAGTGACGATGAAAAGTTTACCGATGCAGACAAAGAAACAGCAAC

AGATGCAGTAAAGGAAGTAGAGTCAAAGGAGACAGAGCCTGAGAGCAGCGCAGAGGCCGAGAAGCCGAAGGCCGCTTCCTGGGTGCACTTTGACAACTTG

AAAG GTGGCAAGCAAATAAAGACATATGATCCATTCAGTAGAAATCCTTTATTCTGCGGAGCTGAAAATACAACTCTTTGGGAGCTCAAAAAG CTATC

TGAACATTTCCATCCTTCTGTGGCCCTTTTTGCAAAGACTATCCTTGAG GGAAATTGTATTCAATACTCAGGGGACCCACTGCAGGATTTCACACTCAT

GAGATTCTTGGATCGATTTGTGTACCGAAATCCAAAGCTACATAAAGGCAAAG AAAATACCGACAGTGTTGTGATGCAACCCAAAAGGAAGCACTTTAT

GAAGAATGTCAGAGATCTCGCTG TGAACAGCAAGGAGTTCCTTGCAAAAGAAGAAAGCCAGATCCCAGTGGATGAAGTGTTCTTCTATAG GTATTACA

AAAAAGTTGCTGTTGTTAAAGACAAACAGAAACGCAGTGCAGATGAAGAAAGTATAGAAGATATTGATGATGAAGAATTTGAAAATATGATTG ACACAT

TTGAAGACGACAACTGCTTCCCACCTGGGAAGGATGATATTGATTTTGCCAG CAATATGAAAAAAGCAAAAGGAGCTAAGGCTGACTTGGAAGACTCAG

AGAGTAGTGACGGCGAACTTGGAGACCTGGATGACGATGAAGTTTCTCTCGGAAGTATGAACGATGAAGACTTTGAGATTGATGAAGATGGAGGAACGTT

CATGGATGTGTCAGATGATGAAAGTGAAGATGCTCCAG AATTTGCTGACGCCAACCCCAAAGCCAATACTAAGAAAAGCAAGAGAAAGAGTGAAGATGA

TTTTGACTTTGCTGGGTCATTTCAAG GACAAAAGAAAAAGAAGAAAAGTTTCAATGACTCCAGCCTGTTTGTCTCTGCTGAGGAG TTTGGCCATCTGC

TGGATGAGAATATGGGCTCCAAGTTTGATACTATTGGCATGAACGCCATGGCTAACAGAGATAATGCAA GTTTCAAACAGCTCAAGTGGGAAGCTGAGC

GAGATGACTGGCTGCACAACAGAGATGTGAAAAGTATCATCAAGAAAAAGAAAAATTTCAGGAAGAAGATGAAAGCCCCTCAGAAACCCAAACGGCAGAG

GAAGTGACATCTTCAGGGTGACAATAAATTAAGATTATACTTACCCTTAGTTTTTGCTAGTCAACCATTTTTCCTCATCTTTCTCTCTAACTCCATACAT

TCCAGACTGTTCAATGGATTTGTAATAAACTGTGG
Translation
MSADQEPVAFLAKQPWRPKQVTEDPDEEDEEDGDEGKNGFSLEEVLRLGGTK - UNI16402 - QDYLMLATLDENEEVVDGGKKGTIDDLQQGELES

FIQNLNLAKYSKSLIEEDEPEKKENTSKKEAKLLKVENKKQKATEGKKTSEKKVKNKTVPEQRPESCPVSKAKKDKQPDVFEFLERQTMLLRPGGKWYDM

EYSGEYSLELQPPDVVSKYKALAQKLYEHEVSLFKSKTNNQKGGSSTWMKAIVSSGTLADRMAAMILLIQDDAVHTLQFVETLMSLVKKKGSKQQCLMAL

DTFKELLITDLLPDSRKLRVFSQHPFHKLEELSSGNKDSRDRRLILWYYEHQLKHLVAEFVQVLETLSHDSLVTTKTRALVAAHELLCDKPEEEKALLVQ

VINKLGDPQNRIATKASHLLEVLLRKHPNMKGVVCAEIERLLFRSNISPKAQYYAICFLNQMVLSHEESELANKLITLYFCFFRTCIKKKDIESKMLSAI

LTGVNRAYPYSQIGDDKVREQVDTLFKVLHVVNFNTSVQALMLLFQVMNSQQTISDRYYTALYR RKMLDPGLTTCSKQAMFLNLIYKSLKADIMLRRVK

AFVKRLLQVTCTQMPPFICGALYLVSEILKAKPDLRSQLDDHP ESDEENFVDVGDDSDDEKFTDADKETATDAVKEVESKETEPESSAEAEKPKAASWV

HFDNLKG GGKQIKTYDPFSRNPLFCGAENTTLWELKK LSEHFHPSVALFAKTILE GNCIQYSGDPLQDFTLMRFLDRFVYRNPKLHKGKE ENTDSV

VMQPKRKHFMKNVRDLAV VNSKEFLAKEESQIPVDEVFFYR RYYKKVAVVKDKQKRSADEESIEDIDDEEFENMID DTFEDDNCFPPGKDDIDFAS 

SNMKKAKGAKADLEDSESSDGELGDLDDDEVSLGSMNDEDFEIDEDGGTFMDVSDDESEDAPE EFADANPKANTKKSKRKSEDDFDFAGSFQG GQKKK

KKSFNDSSLFVSAEE FGHLLDENMGSKFDTIGMNAMANRDNAS SFKQLKWEAERDDWLHNRDVKSIIKKKKNFRKKMKAPQKPKRQRK

For any suggestions or comments, please send an email to unitrap@crg.es