Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024085 (Man2a1)
Chromosomal location
Chr 17: 64950989 - 65104450 (+)
Description
mannosidase 2, alpha 1 Gene [Source:MGI Symbol;Acc:MGI:104669]
RefSeq_dna
NM_008549 
RefSeq_peptide
NP_032575.1 
UniGene
Mm.2433 
MGI
MGI:104669 
Uniprot/SWISSPROT
P27046 
Uniprot/SPTREMBL
Q8C4L1 
Human Ortholog
ENSG00000112893 (MAN2A1)
Omim not available
UniTrap UNI32820
Vector Insertion
Chr 17: 64951211 - 64973867
Public Clones (sanger) IST14459E3 (tigm) IST11117A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9028
Vector Insertion
Chr 17: 64974792 - 64985823
Public Clones RST596 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8823
Vector Insertion
Chr 17: 64985996 - 65000535
Public Clones TEA128 (baygenomics)
Private Clones OST432549 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10306
Vector Insertion
Chr 17: 65084408 - 65090019
Public Clones KST059 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000086723
Sequence
AGCCCTCGGCGATCGCCGGCTGGAGTCCTCAGTCTTCTGCCTCCTTCGGGTGAGGACCGCGTCCTGGCCCCGAGTCCATCGAGGAAAATGAAGTTAAGTC

GCCAGTTCACCGTGTTTGGCAGCGCGATCTTCTGCGTCGTAATCTTCTCACTCTACCTGATGCTGGACAGGGGTCACTTGGACTACCCTCGGGGCCCGCG

CCAGGAGGGCTCCTTTCCGCAG - UNI32819 - GGCCAGCTTTCAATATTGCAAGAAAAGATTGACCATTTGGAGCGTTTGCTCGCTGAGAACAACG

AGATCATCTCAAATATCAGAGACTCAGTCATCAACCTGAGCGAGTCTGTGGAGGACGGCCCGCGGGGGTCACCAGGCAACGCCAGCCAAGGCTCCATCCA

CCTCCACTCGCCACAGTTGGCCCTGCAGGCTGACCCCAGAGACTGTTTGTTTGCTTCACAGAGTGGGAGTCAGCCCCGGGATGTGCAG ATGTTGGATGT

TTACGATCTGATTCCTTTTGATAATCCAGATGGTGGAGTTTGGAAGCAAGGATTTGACATTAAGTATGAAGCGGATGAGTGGGACCATGAGCCCCTGCAA

GTGTTTGTGGTGCCTCACTCCCATAATGACCCAG - UNI9028 - GTTGGTTGAAGACTTTCAATGACTACTTTAGAGACAAGACTCAGTATATTTTT

AATAACATGGTCCTAAAGCTGAAAGAAGACTCAAGCAGGAAGTTTATGTGGTCTGAGATCTCTTACCTTGCAAAATGGTGGGATATTATAGATATTCCGA

AGAAGGAAGCTGTTAAAAG - UNI8823 - TTTACTACAGAATGGTCAGCTGGAAATTGTGACCGGTGGCTGGGTTATGCCTGATGAAGCCACTCCAC

ATTATTTTGCCTTAATTGACCAACTAATTGAAGGGCACCAATGGCTGGAAAAAAATCTAG GAGTGAAACCTCGATCGGGCTGGGCCATAGATCCCTTTG

GTCATTCACCCACAATGGCTTATCTTCTAAAGCGTGCTGGATTTTCACACATGCTCATCCAGAGAGTCCATTATGCAATCAAAAAACACTTCTCTTTGCA

TAAAACGCTGGAGTTTTTCTGGAGACAGAATTGGG ATCTTGGATCTGCTACAGACATTTTGTGCCATATGATGCCCTTCTACAGCTACGACATCCCTCA

CACCTGTGGGCCTGATCCTAAAATATGCTGCCAGTTTGATTTTAAACGGCTTCCTGGAGGCAGATATGGTTGTCCCTGGGGAGTTCCCCCAGAAGCAATA

TCTCCTGGAAATGTCCAAAGCAG GGCTCAGATGCTATTGGATCAGTACCGGAAAAAGTCAAAACTTTTCCGCACTAAAGTTCTGCTGGCTCCACTGGGA

GACGACTTTCGGTTCAGTGAATACACAGAGTGGGATCTGCAGTGCAGGAACTACGAGCAACTGTTCAGTTACATGAACTCGCAGCCTCATCTGAAAGTGA

AG ATCCAGTTTGGAACCTTGTCAGATTATTTCGACGCATTGGAGAAAGCGGTGGCAGCCGAGAAGAAGAGTAGCCAGTCTGTGTTCCCTGCCCTGAGTG

GAGACTTCTTCACGTACGCTGACAGAGACGACCATTACTGGAGTGGCTACTTCACGTCCAGACCTTTCTACAAACGAATGGACAGAATAATGGAATCTCG

TATAAG GGCTGCTGAAATTCTTTACCAGTTGGCCTTGAAACAAGCTCAGAAATACAAGATAAATAAATTTCTTTCATCACCTCATTACACAACACTGAC

AGAAGCCAGAAGGAACTTAGGACTATTTCAGCATCATGATGCCATCACAGGAACCGCGAAAGACTGGGTGGTTGTGGACTATGGTACCAG ACTCTTTCA

GTCATTAAATTCTTTGGAGAAGATAATTGGAGATTCTGCATTTCTTCTCATTTTAAAGGACAAAAAGCTGTACCAGTCAGATCCTTCCAAAGCCTTCTTA

GAGATG GATACGAAGCAAAGTTCACAAGATTCTCTGCCCCAAAAAATTATAATACAACTGAGCGCACAGGAGCCAAG GTACCTTGTGGTCTACAATCC

CTTTGAACAAGAACGGCATTCAGTGGTGTCCATCCGGGTAAACTCCGCCACAGTGAAAGTGCTGTCTGATTCGGGAAAACCGGTGGAGGTTCAAGTCAGT

GCAGTTTGGAACGACATGAGGACAATTTCACAAGCAGCCTATGAG GTTTCTTTTCTAGCTCATATACCACCACTGGGACTGAAAGTGTTTAAGATCTTA

GAGTCACAAAGTTCAAGCTCACACTTGGCTGATTATGTCCTATATAATAATGATGGACTAGCAGAAAATGGAATATTCCACGTGAAGAACATGGTGGATG

CTGGAGATGCCATAACAATAGAGAATCCCTTCCTGGCGATTTGGTTTGACCGATCTGGGCTGATGGAG AAAGTGAGAAGGAAAGAAGACAGTAGACAGC

ATGAACTGAAGGTCCAGTTCCTGTGGTACGGAACCACCAACAAAAGGGACAAGAGCGGTGCCTACCTCTTCCTGCCTGACGGGCAGGGCCAG CCATATG

TTTCCCTAAGACCGCCCTTTGTCAGAGTGACACGTGGAAGGATCTACTCAGATGTGACCTGTTTCCTCGAACACGTTACTCACAAAGTCCGCCTGTACAA

CATTCAGG GAATAGAAGGTCAGTCCATGGAAGTTTCTAATATTGTAAACATCAGGAATGTGCATAACCGTGAGATTGTAATGAGAATTTCATCTAAAAT

AAACAACCAAAATAGATATTATACTGACCTAAATGGATATCAG ATTCAGCCTAGAAGGACCATGAGCAAATTGCCTCTTCAAGCCAACGTTTACCCGAT

GTGCACAATGGCGTATATCCAGGATGCTGAGCACCGGCTCACGCTGCTCTCTGCTCAGTCTCTAGGTGCTTCCAGCATGGCTTCTG GTCAGATTGAAGT

CTTCATGGATCGAAGGCTCATGCAGGATGATAACCGTGGCCTTGGGCAAGGCGTCCATGACAATAAGATTACAGCTAATTTGTTTCGAATCCTCCTCGAG

AAGAGAAGCGCTGTGAACATG - UNI10306 - GAAGAAGAAAAGAAGAGCCCTGTCAGCTACCCTTCCCTCCTCAGCCACATGACTTCGTCCTTCCT

CAACCATCCCTTTCTCCCCATGGTACTAAGTGGCCAGCTCCCCTCCCCTGCCTTTGAGCTGCTGAGTGAATTTCCTCTGCTGCAGTCCTCTCTACCTTGT

GATATCCATCTGGTCAACCTGCGGACAATACAATCAAAG ATGGGCAAAGGCTATTCGGATGAGGCAGCCTTGATCCTCCACAGGAAAGGGTTTGATTGC

CAGTTCTCCAGCAGAGGCATCGGGCTACCCTGTTCCACTACTCAGGGAAAG ATGTCAGTTCTGAAACTTTTCAACAAGTTTGCTGTGGAGAGTCTCGTC

CCTTCCTCTCTGTCCTTGATGCACTCCCCTCCAGATGCCCAGAACATGAGTGAAGTCAGCCTGAGCCCCATGGAGATCAGCACGTTCCGTATCCGCTTGC

GTTGGACCTGACCCAGACTTGAGCAGAGAAACTCCGGCTTTGTTACCGTCCTTGGTTTAACGTGCAATAACTAAGCACATTACTTTAGCTTCTGGCTACT

GTGAGAACATGAATTCTGTGATTCTGTTTTTTTGTTTTGTTTTGTTTTGTTTTTTAAACCAATCTAGTAAGAAAAAGCCATGCTTTAAAAAAAGGTTTCT

TTCTCTGAGTTTGTCCCACAGCTACCGTTATCAGTATGAACTGAGGTAACAAAAATGAAGAACTATTGAAAGATAAGCCCTCAACAGACTGCATCTCAGG

TTAAATGCTAACTATGTTTGCATTGAGGGTTGTAAAGAGATTCTCTAGAAGTATTCTTATCTCTGATCATGTTTTATTAAAAAAATACCCATTTGACTTA

AATAGAAAGAAAAATCAGAAGTTGGTAGGTAACAGCTTAATGGCCAAAGTAGTTGTAATCATTGATATAAATTTGAATATTTTGTATGTTAAAATAATGT

GGAAAAGTGCAATCCCTCAACCCTTATGATAAATGTAGTTGGTTTTCATACTCTTTTCCAATGAACCTCTTGGCTACCCTTTCCTACCCACACATTTAAA

AAAATAAGTGATAATTTTAGTCGTTCACCAGTAGAAAAAGAGGTGTATTTTCATTACTTGACAACATGGGATGGGTGCAATTTATTCCATTGTCACTGAA

ACAGAAGAAGCAGTTCCACTTTAGGTACCACAAGGTGTCTTTCTATACAGCTCATTTGAATACAGGTGTTCCAAGGTGGGGTTTTCTATTTTTAAATTAC

CATATCAAAAATAAATGTGCCTTATTTTTTTATAAGTCTTGTTAAATCTTATTACTGTCCATATTACTGTTTGGGAGGTGGGGTATTGGGAGGTTGGGAT

AGGGGGTGGGTACTTTCTATGACACATAAATTATGTAAAATTTTTTGCTTGATAATGCTGGCCACATCCTGATCTGTGTCATTACATTTGTGGTGATGTT

ACTCTAAACATTTTGACTATTTGAATGTACTGAGATGTCAGAAAACGAAACAAGGGAGAAAAATATTGCTAATTAAAATATGCTGCTGCCAAGGAAACTG

CAAGTTGAAGCAAGGATTTCGTAACCCACAAGATCCAAGTACTTCTTGCATTTCACAGTACTTAACCGCGTTAAAGAGAGAATGCTTTAAAAATAGACTG

TTTTCTAAAATCCTCTGTGTGTAGCTCATCTTATGTTCCTTACTAAAGAACACGTTCCAAACATTTGTGTGTGGTAAACTCAGCGTGTTAGTCTAGCCCA

TGTACCATCATGGGACCTTTGAGGTCATTTGAGATCATTGTTTCTGTAATAGAATAATAGTATTTAATTTTGGTATAGAAAGAATGCTTTGGCTATATCC

ACTTTTGAAAAATTCTCCTCAGTGTCTTAACCTAATTTAGTATTCTTTGACTTTAAACCTCCACTTACCTCTTACCATTCCAGTACATTACAGAGAAAAG

CATTTCTGCCTCACTGTTTATTCTGATCGTCATCTGGATTCTTCCTCAAGATGCAGCTCCTACATTCGCTGTTCTGTTGAGTTCCTAAAATCCTTTGCCT

ATAATCATTAAGGAAATACCAGAATGACAGGACCATTGCAAGGGTATAATTTCATGCAGTAAGCATGTGACGTACATTCCCTTCCTCATTTGTTGGGGAA

TAAGCAACTGAAAGTACAACAAAACCACTTCCTCCTATAACCTCTGCAGACGCTAGCTAGGACGACCAAGCGCCAGTCCCACGAATATGATCTATTTTCT

TGTTGTATCTTAAGTGTATGCCTTCCTGTGGATGTTCACTGTGCTCTGTGGTTAAGTGGCTATGCTTAATCACTACAGAAGTTCTGATGAGGCCAAATGA

AACCAGTGGCTGACATAAATAATAAACAAAAACAGCAGACACAGGGGACCCACTCTGTGTTCTGGCCACCAGCTCCTTATTCACAGGTGAAGCAGAAACT

CTATGTAACCAGCAAGCTTCTGCTTTTTAAAGTTATTTTCACATTACAACACTGGGGAAATGAAGAGAGGGTGTCTTTTGCTTTGGGTTATGGTCAGAAA

CTGGTTTCTCTGGCACACGTGGGCAGTCAGCCACACTTCAGACCTGACAGCGGGGGAGGGGGGGGGCGGTCTGTTTAGTTAGGCTTGGTACATCTGTTAT

CACAGATGCTCAGTGGACCAAGACTGTCTCGCTACTCTCTCCCCACTCTCTGAAATTTTAATTTTGTTTAGAGGTGCATGGTTCAAATATCAGCATTCTA

AAAAAAAAAATTGATTTAAGAAAATGCTGTATGATGTTAGAAGACATTGTAATTATCATCCCGTGTCTTTGCTGTACTCGTGCTGAAGTGTTTTCACAGT

CCTTTGTCTAGAAGAAAATGTTTACTTTCATTGTGATTATTTTGCTCATTGAAATCAACAGGTTTTGATATTTTTCTCTTGGAAGATTTTTATAACTTTT

TGGGAATATGTAATATAAGATCTCTAATAAAATATAATCTTATCCTGTG
Translation
MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPRGPRQEGSFPQ - UNI32819 - GQLSILQEKIDHLERLLAENNEIISNIRDSVINLSESVEDG

PRGSPGNASQGSIHLHSPQLALQADPRDCLFASQSGSQPRDVQ MLDVYDLIPFDNPDGGVWKQGFDIKYEADEWDHEPLQVFVVPHSHNDPG - UNI9

028 - GWLKTFNDYFRDKTQYIFNNMVLKLKEDSSRKFMWSEISYLAKWWDIIDIPKKEAVKS - UNI8823 - SLLQNGQLEIVTGGWVMPDEATP

HYFALIDQLIEGHQWLEKNLG GVKPRSGWAIDPFGHSPTMAYLLKRAGFSHMLIQRVHYAIKKHFSLHKTLEFFWRQNWD DLGSATDILCHMMPFYSY

DIPHTCGPDPKICCQFDFKRLPGGRYGCPWGVPPEAISPGNVQSR RAQMLLDQYRKKSKLFRTKVLLAPLGDDFRFSEYTEWDLQCRNYEQLFSYMNSQ

PHLKVK IQFGTLSDYFDALEKAVAAEKKSSQSVFPALSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESRIR RAAEILYQLALKQAQKYKINKFLS

SPHYTTLTEARRNLGLFQHHDAITGTAKDWVVVDYGTR RLFQSLNSLEKIIGDSAFLLILKDKKLYQSDPSKAFLEM DTKQSSQDSLPQKIIIQLSAQ

EPR RYLVVYNPFEQERHSVVSIRVNSATVKVLSDSGKPVEVQVSAVWNDMRTISQAAYE VSFLAHIPPLGLKVFKILESQSSSSHLADYVLYNNDGLA

ENGIFHVKNMVDAGDAITIENPFLAIWFDRSGLME KVRRKEDSRQHELKVQFLWYGTTNKRDKSGAYLFLPDGQGQ PYVSLRPPFVRVTRGRIYSDVT

CFLEHVTHKVRLYNIQG GIEGQSMEVSNIVNIRNVHNREIVMRISSKINNQNRYYTDLNGYQ IQPRRTMSKLPLQANVYPMCTMAYIQDAEHRLTLLS

AQSLGASSMASG GQIEVFMDRRLMQDDNRGLGQGVHDNKITANLFRILLEKRSAVNM - UNI10306 - EEEKKSPVSYPSLLSHMTSSFLNHPFLP

MVLSGQLPSPAFELLSEFPLLQSSLPCDIHLVNLRTIQSK MGKGYSDEAALILHRKGFDCQFSSRGIGLPCSTTQGK MSVLKLFNKFAVESLVPSSLS

LMHSPPDAQNMSEVSLSPMEISTFRIRLRWT

For any suggestions or comments, please send an email to unitrap@crg.es