Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024101 (ORF19)
Chromosomal location
Chr 17: 66460963 - 66468787 (+)
Description
open reading frame 19 Gene [Source:MGI Symbol;Acc:MGI:1916017]
RefSeq_dna
NM_001037757 NM_026833 
RefSeq_peptide
NP_081109.1 NP_001032846.1 
UniGene
Mm.296545 
MGI
MGI:1916017 
Uniprot/SPTREMBL
Q8VDD8 Q3U473 
Human Ortholog
ENSG00000181404 (WASH4P)
Omim not available
UniTrap UNI36586
Vector Insertion
Chr 17: 66461072 - 66463202
Public Clones IST12101E4 (tigm) IST12101E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17736
Vector Insertion
Chr 17: 66463202 - 66463357
Public Clones not available
Private Clones OST437208 (lexicon) OST41208 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22745
Vector Insertion
Chr 17: 66463357 - 66465010
Public Clones not available
Private Clones OST285852 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22015
Vector Insertion
Chr 17: 66465123 - 66465293
Public Clones not available
Private Clones OST311396 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000072383
Sequence
ACGCTCACGTGAGGACGCCGCCTTGGG - UNI17736 - - UNI36586 - GCATCATGACACCGGTGAAGACCCAGTGCTCCTTGGCGGGCCAGCT

TTATGCAGTGCCCCTCATCCAGCCCGACCTGCGACGAGAGGAGGCAATCCAGCAAGTGGCAGATGCCCTGCAGTACCTACAGAACATCTCTGGAGACATC

TTCAGCAG - UNI17736 - - UNI22745 - GATCTCCCGACGAGTAGAGCTGAGTCGGCGCCAGCTGCAGGCCATTAGTGAGAGGGTCTCCTTGG

CCCAGGCTAAGATAGAGAAGATCAAGGGCAGTAAGAAGGCCATCAAG - UNI22015 - GTCTTTTCTAGTGCCAAGTACCCAGCACCAGAGCACCTG

CAGGAATACGGCTCCATCTTTACTGGCGCCTTGGACCCTGGTCTGCAGAGAAGACCCCGTTACAGGATCCAGAGCAAGCACCGCCCACTGGATGAGCGGG

CTCTGCAG GAGAAGCTGAAATACTTTCCCGTGTGTGTGAACACCAAGTCGGAGCCTGAGGATGAAGCTGAGGAGGGACTTGGGGGTCTTCCCAGCAACA

TCAGCTCCATCAGCTCCCTGCTGCTCTTCAACACCACAGAGAATCT GTATAAGAAGTATGTTTTCCTGGACCCTCTGGCTGGTGCAGTAACAAAAACGC

ACACGATGCTGGGCACAGAGGAGGAGAAATTGTTCGATGCCCCTCTGTCTATCAGCAAGAGAGAGCAGCTGGAGCGGCAG GCTCCAGAAAACTACTTCT

ACGTGCCAGACCTGGGCCAGGTTCCTGAGATCGACGTGCCATCCTACCTACCCGATTTACCCGGCGTCGCAGACGACCTGATGTACAGTGCGGATTTGGG

CCCTGGCATTGCCCCGTCTGCTCCTGGTGCTATCCCAGAGTTGCCTGCCTTCCACACAGAGGTGGCAGAACCTCTCCAGCCAG AGCTAGAGAATGAAGT

ACTGTTGGCAGCACCGCCCCCGCCTCCTCCCCCACCGCCGCCACCTCCCCCAGCTCCCACAGCATTGGTCAGTACCCCACAGCCACCGATGTTCCCTGAC

ATGGCAACTGCTGCTGGCCAGGTTGCCAGGGAAGAAGACTCTAGCAGCAGCATGGCCCACACAG CCTCTGTTCAGGGAGCCCCTAAGGAGGTGGTTGAC

CCCTCCAGTGGCCGGGCCACTCTGCTCGAGTCCATCCGCCAAGCTGGGGGCATTGGCAAGGCCAAGCTACGCAGCGTGAAGGAGCGCAAACTGGAGAAGA

AGAAACAGAAGGAGCAGGAGCAAG TGAGAGCCACGAGCCAAGGTGGGGACTTGATGTCAGATCTCTTCAACAAACTTGTCATGAGGCGCAAAG GTATC

TCTGGAAAGGGACCTAGCACTGGAACCAGTGAGGGACCTGGAGGAGCCTTCTCTCGAATGTCAGACTCCATCCCACCGCTGCCACCCCCACAGCAGCCGG

CAGGAGACGAGGATGAGGAGGACTGGGAGTCCTAAGAGTGCTTTGGCCATTCTCCCACATGGCAGAGCAGCTGGCAGGGGCTCCTCGGCCAGTTGGGGCC

TTTCAGGGCCTGTTGCCCAAGGAGGTGCAGGGGGCTGGGCAGGTGTCCCAGGCCTGTGCCTAATTCCTCTTCATGGAGTCGGGACTGTATGAGCCATCTG

CTGGCTTTGCTGAAGAGCTTCTTCCTTCAAAGGATCCTGAGAGAAAACAGCAACACGGCGGAATAAAGAAAGTAACTGTAGACCTGAACCCAAGCCAACA

GTGGCCTTTAATAAATGAAGAGTAGCCATGCGGGCTGCGGCTTCTG
Translation
 - UNI17736 - - UNI36586 - MTPVKTQCSLAGQLYAVPLIQPDLRREEAIQQVADALQYLQNISGDIFSR - UNI17736 - - UNI2274

5 - RISRRVELSRRQLQAISERVSLAQAKIEKIKGSKKAIK - UNI22015 - VFSSAKYPAPEHLQEYGSIFTGALDPGLQRRPRYRIQSKHRPLD

ERALQ EKLKYFPVCVNTKSEPEDEAEEGLGGLPSNISSISSLLLFNTTENL LYKKYVFLDPLAGAVTKTHTMLGTEEEKLFDAPLSISKREQLERQ A

PENYFYVPDLGQVPEIDVPSYLPDLPGVADDLMYSADLGPGIAPSAPGAIPELPAFHTEVAEPLQPE ELENEVLLAAPPPPPPPPPPPPPAPTALVSTP

QPPMFPDMATAAGQVAREEDSSSSMAHTA ASVQGAPKEVVDPSSGRATLLESIRQAGGIGKAKLRSVKERKLEKKKQKEQEQV VRATSQGGDLMSDLF

NKLVMRRKG GISGKGPSTGTSEGPGGAFSRMSDSIPPLPPPQQPAGDEDEEDWES
Transcript ENSMUST00000116556
Sequence
CTTGGGGTAAGTGTGCAGGGTGGGCGAGGGGCGGACTGGGAGCGCAGGACCGGGAGGAGGCCGCGACCCTGCCGCCCACCGGCTGGAG - UNI17736 

- - UNI36586 - GCATCATGACACCGGTGAAGACCCAGTGCTCCTTGGCGGGCCAGCTTTATGCAGTGCCCCTCATCCAGCCCGACCTGCGACGAGA

GGAGGCAATCCAGCAAGTGGCAGATGCCCTGCAGTACCTACAGAACATCTCTGGAGACATCTTCAGCAG - UNI17736 - - UNI22745 - GATC

TCCCGACGAGTAGAGCTGAGTCGGCGCCAGCTGCAGGCCATTAGTGAGAGGGTCTCCTTGGCCCAGGCTAAGATAGAGAAGATCAAGGGCAGTAAGAAGG

CCATCAAG - UNI22015 - GTCTTTTCTAGTGCCAAGTACCCAGCACCAGAGCACCTGCAGGAATACGGCTCCATCTTTACTGGCGCCTTGGACCCT

GGTCTGCAGAGAAGACCCCGTTACAGGATCCAGAGCAAGCACCGCCCACTGGATGAGCGGGCTCTGCAG GAGAAGCTGAAATACTTTCCCGTGTGTGTG

AACACCAAGTCGGAGCCTGAGGATGAAGCTGAGGAGGGACTTGGGGGTCTTCCCAGCAACATCAGCTCCATCAGCTCCCTGCTGCTCTTCAACACCACAG

AGAATCT GTATAAGAAGTATGTTTTCCTGGACCCTCTGGCTGGTGCAGTAACAAAAACGCACACGATGCTGGGCACAGAGGAGGAGAAATTGTTCGATG

CCCCTCTGTCTATCAGCAAGAGAGAGCAGCTGGAGCGGCAG GCTCCAGAAAACTACTTCTACGTGCCAGACCTGGGCCAGGTTCCTGAGATCGACGTGC

CATCCTACCTACCCGATTTACCCGGCGTCGCAGACGACCTGATGTACAGTGCGGATTTGGGCCCTGGCATTGCCCCGTCTGCTCCTGGTGCTATCCCAGA

GTTGCCTGCCTTCCACACAGAGGTGGCAGAACCTCTCCAGCCAG AGCTAGAGAATGAAGTACTGTTGGCAGCACCGCCCCCGCCTCCTCCCCCACCGCC

GCCACCTCCCCCAGCTCCCACAGCATTGGTCAGTACCCCACAGCCACCGATGTTCCCTGACATGGCAACTGCTGCTGGCCAGGTTGCCAGGGAAGAAGAC

TCTAGCAGCAGCATGGCCCACACAG CCTCTGTTCAGGGAGCCCCTAAGGAGGTGGTTGACCCCTCCAGTGGCCGGGCCACTCTGCTCGAGTCCATCCGC

CAAGCTGGGGGCATTGGCAAGGCCAAGCTACGCAGCGTGAAGGAGCGCAAACTGGAGAAGAAGAAACAGAAGGAGCAGGAGCAAG TGAGAGCCACGAGC

CAAGGTGGGGACTTGATGTCAGATCTCTTCAACAAACTTGTCATGAGGCGCAAAG GTATCTCTGGAAAGGGACCTAGCACTGGAACCAGTGAGGGACCT

GGAGGAGCCTTCTCTCGAATGTCAGACTCCATCCCACCGCTGCCACCCCCACAGCAGCCGGCAGGAGACGAGGATGAGGAGGACTGGGAGTCCTAAGAGT

GCTTTGGCCATTCTCCCACATGGCAGAGCAGCTGGCAGGGGCTCCTCGGCCAGTTGGGGCCTTTCAGGGCCTGTTGCCCAAGGAGGTGCAGGGGGCTGGG

CAGGTGTCCCAGGCCTGTGCCTAATTCCTCTTCATGGAGTCGGGACTGTATGAGCCATCTGCTGGCTTTGCTGAAGAGCTTCTTCCTTCAAAGGATCCTG

AGAGAAAACAGCAACACGGCGGAATAAAGAAAGTAACTGTAGACCTGAACCCAAGCCAACAGTGGCCTTTAATAAATGAAGAGTAGCCATGCGGGCTGCG

GCTTCTG
Translation
LGVSVQGGRGADWERRTGRRPRPCRPPAGG - UNI17736 - - UNI36586 - GIMTPVKTQCSLAGQLYAVPLIQPDLRREEAIQQVADALQYLQ

NISGDIFSR - UNI17736 - - UNI22745 - RISRRVELSRRQLQAISERVSLAQAKIEKIKGSKKAIK - UNI22015 - VFSSAKYPAPEH

LQEYGSIFTGALDPGLQRRPRYRIQSKHRPLDERALQ EKLKYFPVCVNTKSEPEDEAEEGLGGLPSNISSISSLLLFNTTENL LYKKYVFLDPLAGAV

TKTHTMLGTEEEKLFDAPLSISKREQLERQ APENYFYVPDLGQVPEIDVPSYLPDLPGVADDLMYSADLGPGIAPSAPGAIPELPAFHTEVAEPLQPE 

ELENEVLLAAPPPPPPPPPPPPPAPTALVSTPQPPMFPDMATAAGQVAREEDSSSSMAHTA ASVQGAPKEVVDPSSGRATLLESIRQAGGIGKAKLRSV

KERKLEKKKQKEQEQV VRATSQGGDLMSDLFNKLVMRRKG GISGKGPSTGTSEGPGGAFSRMSDSIPPLPPPQQPAGDEDEEDWES

For any suggestions or comments, please send an email to unitrap@crg.es