Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024127 (Prepl)
Chromosomal location
Chr 17: 85462826 - 85489548 (-)
Description
prolyl endopeptidase-like Gene [Source:MGI Symbol;Acc:MGI:2441932]
RefSeq_dna
NM_145984 
RefSeq_peptide
NP_666096.2 
UniGene
Mm.259035 Mm.468622 
MGI
MGI:2441932 
Uniprot/SWISSPROT
Q8C167 
Uniprot/SPTREMBL
A1L337 Q8BKS6 
Human Ortholog
ENSG00000138078 (PREPL)
Omim 606407 - HYPOTONIA-CYSTINURIA SYNDROME  
UniTrap UNI14338
Vector Insertion
Chr 17: 85487679 - 85489549
Public Clones (sanger) FHCRC-GT-S18-7F1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18778
Vector Insertion
Chr 17: 85482656 - 85487679
Public Clones not available
Private Clones OST414486 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16906
Vector Insertion
Chr 17: 85480611 - 85481311
Public Clones not available
Private Clones OST452406 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22813
Vector Insertion
Chr 17: 85477965 - 85480403
Public Clones not available
Private Clones OST284163 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000064592
Sequence
TTCGGCTGGACAAGGCTGAGGTGACTGCAGCTCCTTCTGGAGAGCTTCGGTTTCTCGTATTTGTCTTCTCTACCTTCGCTCGTCCAGCTGTCTTTCGATT

TGC - UNI14338 - AGTAAGATTGAAAAAGTACCACCTAACCAAGTGTCTGCAGAATAAACCCAGGATAGCAGGATTAGCAAGAAACATCCCAAGTC

GGAGCTTCTCGTGTAAG - UNI14338 - - UNI18778 - GATCTTCTGCCTATTAAGCCAGAAAGTGAAAAGCCCATTTCTGAAAACATGGATGC

ATTTGAAAAAGTGAGAACAAGACTGGAAACACAGCCACAGGAAGAGTACGAAGTCGTCAATGCAGAG ATTAAACATGGCGGCTTTGTTTATTATCAAGA

AGGTTGCTGCTTGGTTCGTTCCAAAGACGAAGAAG - UNI16906 - CTGACAGTGATAATTATGAAGTTTTATTCAACCTGGAAGAACTTAAATTGG

ATCAGCCTTTCATTGATTGCATCAGAGTTGCTCCTGATGAGAAATACGTGGCTGCCAAGATAAGGACGGAGGATTCTGAAACCTCCACCTTAGTAGTTGT

GAAGCTCAGTGACCAGCCTGTAATGGAAGCGTCGTTCCCAAACGTGTCCAGTTTCG - UNI22813 - AATGGGTGAAGGATGAAGAAGATGAAGATG

TCTTATTCTACACCTTCCAAAGGAACCTTCGCTGCCACGATGTGTATCGAGCCACATTTGGTGACAACAAGCGCAATGAACGGTTCTACACAGAGAAAGA

CCCAAG CTATTTTGTCTTCCTCTACCTTACAAAAGACAGTCGTTTCCTCACACTGAATATTATGAACAAGACGACTTCCGAGGTGTGGTTGATAGATGG

CCTGAGCCCGTGGGACCCACCAGTCCTTATTCAGAAGAGGATACACGGAATGCTTTACTATGTTGAGCATCGAGATGATGAGTTATACATCCTGACGAAT

GTTGGAGAACCTACAGAATTCAAG CTGATGCGGACGGCAGCTGATGCCCCTGCTATTATGAATTGGGATTTATTTTTCACAATGAAGAGAAATACCAAG

GTTGTAGACTTGGACATGTTTAAGGACCACTGTGTTCTGTTCCTGAAACACAGCAATCTCCTCTATGTTAATGTGATTGGTCTGGCCGACGACTCAGTGC

GCTCCCTAAAG CTCCCGCCTTGGGCCTGTGGATTCATAATGGATACAAATTCTGACCCAAAGAACTGCCCCTTTCAGCTTTGCTCTCCAATAAGACCCC

CAAAATATTACACATACAAATTTGCAGAAGGCAAACTGTTTGAGGAAACTGGTCACGAAGATCCGATTACAAAGACCAGCCGTGTTTTACGCATAGAAGC

CAAAAGCAAG GATGGAAAGTTAGTGCCCATGACAGTTTTTCACAAAACCGATTCTGAGGACCTGCAGAGGAAGCCTCTCTTGGTGCACGTCTATGGAGC

GTACGGAATGGACCTGAAAATGAATTTCAGGCCTGAAAAGCGGGTCTTGGTGGATGATGGATGGATCTTAGCTTATTGCCATGTTAG GGGTGGTGGCGA

GCTAGGTCTCCAGTGGCATGCCGATGGCCGACTAACTAAAAAGCTCAATGGCCTTGCTGACTTAGTGGCTTGCATTAAGACGCTTCACAGCCAGGGCTTT

TCTCAGCCGAGCCTAACAACGCTGAGCGCTTTCAGTGCTGGAGGTGTGCTCGTGGGAGCACTGTGTAATTCTAAGCCAGAGCTCCTGAGAGCCGTGACCC

TGGAG GCACCTTTCTTGGATGTCCTCAATACCATGTTGGATACCACCCTTCCTCTGACACTGGAAGAGTTGGAAGAGTGGGGGAACCCGTCATCTGATG

AGAAACACAAGAACTACATAAAGCGCTACTGTCCCTGCCAGAACATTAAGCCTCAG CATTATCCTTCAGTTCACATCACAGCCTATGAAAACGATGAGC

GAGTGCCGCTGAAAGGAATCGTGAACTACACAGAGAAGCTTAAGGAGGCCGTGGCTGAGCACACCAAGGGAGCGGGTGAAG GCTATCAGCCCCCCAACA

TTATCCTAGATATTCAGCCTGGGGGGAACCACGTGATTGAGGATTCTCACAAAAAG ATCACAACCCAGATGAAATTCCTATATGAGGAACTTGGACTTG

ACAGCACTGATGCTTTCGAGGCGCTGAAGAAATACCTAAAGTTCTGAAATGCTGCATTCAGCTGGGAACTGGAAACACATGGAAATAATAATTAGTTTTG

TTTCCAGTTAGTTTAGCAAAAGTGAAGTTTTTTTTAAGTTATTATATAATTTTTTAAAAGTTGTCTCTTTGTGTAATTTTGCTTAATACTTGCTCATACT

GTTCCCACCAGCACACACCCCCTGGCCTAGGAAAGTCGTTTTCCATCATGCTCCTCAGTAGGATGTAGAGAAGGGAGCCAGAAGGACTGGGGCAGGAGAA

CAGGAGAACGCCTGGCCTCCCAATCAGTCTTTTAACAGAATTTTACAATTCAAAATCCTTCCCCTTTGCTAGTGAATATTTGTAGGCGCTGTGGCTGTGA

GTCACCTTGCAATTTCCACAACTCCACTTTAAAGAAAAGGATAGCATTCTTCATATTTAAATGCTTTAGTATTTTGGCATAATCTTTTAAACACTTTAAA

AACAGTGCATTCGTGCTACAGAAATATCTAAGAATTGATGCCATTCATGAGTCTGCTCAGCCCTGTGCGTACGTGATGTTCTGGGTGGCCATCTCTTAGG

GAGCTTCCTTCCTAACACGAGCTATAGAGGATGTCCAGTGCACTGGAGTAGCACGCCCGACTGGAAACAAAGCATCTGTCTCTGAAAGCGGCCTGCTGAT

GGAGGGGAGCCTTCGTGCTGTGCTCCAAGACCAGGCCCTCTCCCTTCTCCAGAGAAATGGCACGGGTGTCAACAGCACTGCCTTTGGAGGCTGAGTTGGT

ACTTAACCTTATTCTCAGCTCTGGAGGAAGATCTGAAATGATCCCCTGTAGATTTAGCACAGTTGATGATTCTCCAAAATTCAGAACCACGAGGAAGACG

TTATCTATGCCGTCCAGCTCTCTTGTGTACACCACAGAGTGACTGTCGTCTCTCAAGAGGCAAAACCAGCCCCGGCTGAGGACCAGCTCTGTGGCATGGA

GTAGACTCAGATCCTGATACAGCCTCAGTGCTGAGCTCGGCTGGGTCTTTTGGACCTGTTTTTAAAAAGAATATTGACATAAATGTTTGATTTTAAGAAT

TATCCACACCCCCCCCAAAAAAATCCCTTGCTTCTGTTTGCCCTTTACACTGTCCAAGTAAGTAAATAACTGCCCAATTATAAAGCATTTATAAATAGTT

GGTCC
Translation
 - UNI14338 -  - UNI14338 - - UNI18778 - MDAFEKVRTRLETQPQEEYEVVNAE IKHGGFVYYQEGCCLVRSKDEEA - UNI1690

6 - ADSDNYEVLFNLEELKLDQPFIDCIRVAPDEKYVAAKIRTEDSETSTLVVVKLSDQPVMEASFPNVSSFE - UNI22813 - EWVKDEEDEDVL

FYTFQRNLRCHDVYRATFGDNKRNERFYTEKDPS SYFVFLYLTKDSRFLTLNIMNKTTSEVWLIDGLSPWDPPVLIQKRIHGMLYYVEHRDDELYILTN

VGEPTEFK LMRTAADAPAIMNWDLFFTMKRNTKVVDLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLK LPPWACGFIMDTNSDPKNCPFQLCSPIR

PPKYYTYKFAEGKLFEETGHEDPITKTSRVLRIEAKSK DGKLVPMTVFHKTDSEDLQRKPLLVHVYGAYGMDLKMNFRPEKRVLVDDGWILAYCHVR R

GGGELGLQWHADGRLTKKLNGLADLVACIKTLHSQGFSQPSLTTLSAFSAGGVLVGALCNSKPELLRAVTLE APFLDVLNTMLDTTLPLTLEELEEWGN

PSSDEKHKNYIKRYCPCQNIKPQ HYPSVHITAYENDERVPLKGIVNYTEKLKEAVAEHTKGAGEG GYQPPNIILDIQPGGNHVIEDSHKK ITTQMKF

LYEELGLDSTDAFEALKKYLKF
Transcript ENSMUST00000072406
Sequence
ATGCTGCAGACGGCCAAATTCTCTCTCCGAGCTTTGAAGCATAGTATTCCTCATCTTGGGAACTGCATGCAGAAACAGAGTTACCGTAACGTCGCTGGTC

CTTATTACAGTAGAGTAAGATTGAAAAAGTACCACCTAACCAAGTGTCTGCAGAATAAACCCAGGATAGCAGGATTAGCAAGAAACATCCCAAGTCGGAG

CTTCTCGTGTAAG - UNI14338 - - UNI18778 - GATCTTCTGCCTATTAAGCCAGAAAGTGAAAAGCCCATTTCTGAAAACATGGATGCATTT

GAAAAAGTGAGAACAAGACTGGAAACACAGCCACAGGAAGAGTACGAAGTCGTCAATGCAGAG ATTAAACATGGCGGCTTTGTTTATTATCAAGAAGGT

TGCTGCTTGGTTCGTTCCAAAGACGAAGAAG - UNI16906 - CTGACAGTGATAATTATGAAGTTTTATTCAACCTGGAAGAACTTAAATTGGATCA

GCCTTTCATTGATTGCATCAGAGTTGCTCCTGATGAGAAATACGTGGCTGCCAAGATAAGGACGGAGGATTCTGAAACCTCCACCTTAGTAGTTGTGAAG

CTCAGTGACCAGCCTGTAATGGAAGCGTCGTTCCCAAACGTGTCCAGTTTCG - UNI22813 - AATGGGTGAAGGATGAAGAAGATGAAGATGTCTT

ATTCTACACCTTCCAAAGGAACCTTCGCTGCCACGATGTGTATCGAGCCACATTTGGTGACAACAAGCGCAATGAACGGTTCTACACAGAGAAAGACCCA

AG CTATTTTGTCTTCCTCTACCTTACAAAAGACAGTCGTTTCCTCACACTGAATATTATGAACAAGACGACTTCCGAGGTGTGGTTGATAGATGGCCTG

AGCCCGTGGGACCCACCAGTCCTTATTCAGAAGAGGATACACGGAATGCTTTACTATGTTGAGCATCGAGATGATGAGTTATACATCCTGACGAATGTTG

GAGAACCTACAGAATTCAAG CTGATGCGGACGGCAGCTGATGCCCCTGCTATTATGAATTGGGATTTATTTTTCACAATGAAGAGAAATACCAAGGTTG

TAGACTTGGACATGTTTAAGGACCACTGTGTTCTGTTCCTGAAACACAGCAATCTCCTCTATGTTAATGTGATTGGTCTGGCCGACGACTCAGTGCGCTC

CCTAAAG CTCCCGCCTTGGGCCTGTGGATTCATAATGGATACAAATTCTGACCCAAAGAACTGCCCCTTTCAGCTTTGCTCTCCAATAAGACCCCCAAA

ATATTACACATACAAATTTGCAGAAGGCAAACTGTTTGAGGAAACTGGTCACGAAGATCCGATTACAAAGACCAGCCGTGTTTTACGCATAGAAGCCAAA

AGCAAG GATGGAAAGTTAGTGCCCATGACAGTTTTTCACAAAACCGATTCTGAGGACCTGCAGAGGAAGCCTCTCTTGGTGCACGTCTATGGAGCGTAC

GGAATGGACCTGAAAATGAATTTCAGGCCTGAAAAGCGGGTCTTGGTGGATGATGGATGGATCTTAGCTTATTGCCATGTTAG GGGTGGTGGCGAGCTA

GGTCTCCAGTGGCATGCCGATGGCCGACTAACTAAAAAGCTCAATGGCCTTGCTGACTTAGTGGCTTGCATTAAGACGCTTCACAGCCAGGGCTTTTCTC

AGCCGAGCCTAACAACGCTGAGCGCTTTCAGTGCTGGAGGTGTGCTCGTGGGAGCACTGTGTAATTCTAAGCCAGAGCTCCTGAGAGCCGTGACCCTGGA

G GCACCTTTCTTGGATGTCCTCAATACCATGTTGGATACCACCCTTCCTCTGACACTGGAAGAGTTGGAAGAGTGGGGGAACCCGTCATCTGATGAGAA

ACACAAGAACTACATAAAGCGCTACTGTCCCTGCCAGAACATTAAGCCTCAG CATTATCCTTCAGTTCACATCACAGCCTATGAAAACGATGAGCGAGT

GCCGCTGAAAGGAATCGTGAACTACACAGAGAAGCTTAAGGAGGCCGTGGCTGAGCACACCAAGGGAGCGGGTGAAG GCTATCAGCCCCCCAACATTAT

CCTAGATATTCAGCCTGGGGGGAACCACGTGATTGAGGATTCTCACAAAAAG ATCACAACCCAGATGAAATTCCTATATGAGGAACTTGGACTTGACAG

CACTGATGCTTTCGAGGCGCTGAAGAAATACCTAAAGTTCTGAAATGCTGCATTCAGCTGGGAACTGGAAACACATGGAAATAATAATTAGTTTTGTTTC

CAGTTAGTTTAGCAAAAGTGAAGTTTTTTTTAAGTTATTATATAATTTTTTAAAAGTTGTCTCTTTGTGTAATTTTGCTTAATACTTGCTCATACTGTTC

CCACCAGCACACACCCCCTGGCCTAGGAAAGTCGTTTTCCATCATGCTCCTCAGTAGGATGTAGAGAAGGGAGCCAGAAGGACTGGGGCAGGAGAACAGG

AGAACGCCTGGCCTCCCAATCAGTCTTTTAACAGAATTTTACAATTCAAAATCCTTCCCCTTTGCTAGTGAATATTTGTAGGCGCTGTGGCTGTGAGTCA

CCTTGCAATTTCCACAACTCCACTTTAAAGAAAAGGATAGCATTCTTCATATTTAAATGCTTTAGTATTTTGGCATAATCTTTTAAACACTTTAAAAACA

GTGCATTCGTGCTACAGAAATATCTAAGAATTGATGCCATTCATGAGTCTGCTCAGCCCTGTGCGTACGTGATGTTCTGGGTGGCCATCTCTTAGGGAGC

TTCCTTCCTAACACGAGCTATAGAGGATGTCCAGTGCACTGGAGTAGCACGCCCGACTGGAAACAAAGCATCTGTCTCTGAAAGCGGCCTGCTGATGGAG

GGGAGCCTTCGTGCTGTGCTCCAAGACCAGGCCCTCTCCCTTCTCCAGAGAAATGGCACGGGTGTCAACAGCACTGCCTTTGGAGGCTGAGTTGGTACTT

AACCTTATTCTCAGCTCTGGAGGAAGATCTGAAATGATCCCCTGTAGATTTAGCACAGTTGATGATTCTCCAAAATTCAGAACCACGAGGAAGACGTTAT

CTATGCCGTCCAGCTCTCTTGTGTACACCACAGAGTGACTGTCGTCTCTCAAGAGGCAAAACCAGCCCCGGCTGAGGACCAGCTCTGTGGCATGGAGTAG

ACTCAGATCCTGATACAGCCTCAGTGCTGAGCTCGGCTGGGTCTTTTGGACCTGTTTTTAAAAAGAATATTGACATAAATGTTTGATTTTAAGAATTATC

CACACCCCCCCCAAAAAAATCCCTTGCTTCTGTTTGCCCTTTACACTGTCCAAGTAAGTAAATAACTGCCCAATTATAAAGCATTTATAAATAGTTGGTC

C
Translation
MLQTAKFSLRALKHSIPHLGNCMQKQSYRNVAGPYYSRVRLKKYHLTKCLQNKPRIAGLARNIPSRSFSCK - UNI14338 - - UNI18778 - DL

LPIKPESEKPISENMDAFEKVRTRLETQPQEEYEVVNAE IKHGGFVYYQEGCCLVRSKDEEA - UNI16906 - ADSDNYEVLFNLEELKLDQPFID

CIRVAPDEKYVAAKIRTEDSETSTLVVVKLSDQPVMEASFPNVSSFE - UNI22813 - EWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDNKRNERF

YTEKDPS SYFVFLYLTKDSRFLTLNIMNKTTSEVWLIDGLSPWDPPVLIQKRIHGMLYYVEHRDDELYILTNVGEPTEFK LMRTAADAPAIMNWDLFF

TMKRNTKVVDLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLK LPPWACGFIMDTNSDPKNCPFQLCSPIRPPKYYTYKFAEGKLFEETGHEDPITKT

SRVLRIEAKSK DGKLVPMTVFHKTDSEDLQRKPLLVHVYGAYGMDLKMNFRPEKRVLVDDGWILAYCHVR RGGGELGLQWHADGRLTKKLNGLADLVA

CIKTLHSQGFSQPSLTTLSAFSAGGVLVGALCNSKPELLRAVTLE APFLDVLNTMLDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPCQNIKPQ HYP

SVHITAYENDERVPLKGIVNYTEKLKEAVAEHTKGAGEG GYQPPNIILDIQPGGNHVIEDSHKK ITTQMKFLYEELGLDSTDAFEALKKYLKF

For any suggestions or comments, please send an email to unitrap@crg.es