Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024130 (Abca3)
Chromosomal location
Chr 17: 24488991 - 24547146 (+)
Description
ATP-binding cassette, sub-family A (ABC1), member 3 Gene [Source:MGI (curated);Acc:Abca3-001]
RefSeq_dna
NM_001039581 NM_013855 
RefSeq_peptide
NP_038883.2 NP_001034670.1 
UniGene
Mm.475679 
MGI
MGI:1351617 
Uniprot/SWISSPROT
Q8R420 
Uniprot/SPTREMBL
Q3TN91 Q6AXE3 Q6PHB8 Q9CVK4 Q9JL37 Q3U3L4 Q80XT2 
Human Ortholog
ENSG00000167972 (ABCA3)
Omim 610921 - SURFACTANT METABOLISM DYSFUNCTION, PULMONARY, 3  
UniTrap UNI16910
Vector Insertion
Chr 17: 24489197 - 24494863
Public Clones not available
Private Clones OST452397 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117337
Sequence
CATCTTTAAGTCTTGATCTCTGGTTGGTGTTGGCACTGTGCCAGCAAGAAGATGGCAGTGCTGCGGCAGCTCACCCTCCTACTCTGGAAGAACTATACCC

TGAAG AAACGGAAGGTTCTAGTGACAGTCCTGGAGCTCTTCCTGCCCCTGCTGTTTTCTGGGATCCTGATTTGGCTTCGCTTGAAGATCCAGTCGGAGA

ATGTGCCCAATGCCACTGTTTACCCGGACCAGTCCATCCAGGAGCTGCCCCTGTTTTTCTCATTCCCTCCACCTGGGGGGACCTGGGAGCTCGCCTATGT

CCCTTCCCACAGCGATGCTGCCAGGACCATCACGGAGACGGTGAAAAGGGAATTCATGATCAAGATGAGAG TGCACGGCTTCTCCTCTGAGAAGGACTT

CGAGGACTACATTCGCTATGACAACCACTCCTCCAGCGTGCTGGCAGCTGTGGTATTTGAGCACAGCTTCAACCACAGCCAGGACCCCCTGCCGCTGGCG

 GTGAAATACCACCTGCGCTTCAGTTACACACGAAGAAATTACATGTGGACCCAAACAGGAAATATTTTCCTAAAAGAGACTGAAGGCTGGCATACCACT

TCACTTTTTCCACTTTTTCCAAGCCCCGGACCGCGGGAACCTTCATCACCTGATGGCGGTGAACCTG GATACATTCGGGAAGGCTTCCTGGCCATGCAA

CATGCTGTAGACAAAGCCATCATGCGTTACCATGCCAACACCTCTGCACAGCAGCTGTTCCAGAAGCTCATGGTGATCACCAAAAGGTTCCCGTTCCCAC

CATACATCTCAGATCCATTCCTCATTGCCATCCAGTACCAGCTTCCTCTGCTGCTCATGCTGAGTTTCACCTACACCTCCCTCACCATCATCCGGGCTGT

GGTGCAGGAGAAGGAGAAAAAACTAAAG GAGTACATGCGCATGATGGGGCTTAACAGCTGGCTACACTGGAGCGCTTGGTTCCTCATGTTCTTCCTATT

CTTCCTCATCGTGGTCTCCTTCATGACCCTCCTGTTCTGTGTCAAA GTGAAGAAGGACATAGCAGTCCTTTCCAACAGCGACCCCTCCCTGGTCCTGGC

GTTCCTGCTGTGTTTTGCAATCTCCTCCATTTCCTTCAGCTTCATGGTCAGCACCTTCTTCAGTAAAG CCAACATAGCAGCAGCCGTGGGTGGCTTCCT

GTACTTCTTCACCTATACCCCCTACTTTTTCGTGGCTCCTCGGTACAACTGGATGACACTGAGTCAAAAGCTCTTGTCCTGTCTCCTATCTAATGTTGCC

ATGGCAATGGGAGCCCAGCTCATAGGAAAATTCGAAGCCAAAG GCACTGGCATCCAGTGGCGGGACCTCCTCAACCCTGTCAACGTGGACGACAATTTC

TGCTTTGGACAAGTGCTGGGGATGCTGCTGCTGGACTCAGCACTCTATGGCCTGGTGACCTGGTACGTGGAGGCTGTCTTCCCAGGCCAGTTTGGCGTAC

CCCAGCCCTGGCACTTCTTCCTTATG CCCTCCTACTGGTGTGGGAACCCAAGAACTGTCGTAGGGAAGGAAGAGGAAGGCAGCGACCCAGAGAAAGCTC

TCAGGAACGAGTACTTTGAAGCCGAGCCAGAGGACTTGGTAGCTGGAATCAAGATCAAGCATCTCTCCAAG GTGTTCCAAGTGGGCAATAAGGACAAGA

TGGGCATCAGAGACCTGACCCTGAACCTCTACGAAGGACAGATAACAGTCCTCCTGGGCCACAATGGTGCTGGGAAGACCACGACCATGTCTCTGCTGAC

AG GCCTCTTCCCCCCTACCAGTGGACATGCTTATATTCATGGGTACGAAATTTCCCAAGACATGGCTCAGATCCGCAAGAGTTTGGGCCTGTGTCCCCA

GCATGATGTACTGTTTGACAACCTGACAGTTGCCGAACATCTTTACTTCTATGCACAG CTGAAAGGCCTCTCTCTCCAGAAGTGTCCTGAGGAAGTCAA

GCAGATGCTACACATCCTCAGCCTGGAGGACAAGCGTGACTTACGGTCCAAGTTCCTGAGTGGGGGCATGAAGCGCAAGCTCTCCATTGGCATCGCCCTC

ATAGCGGGCTCTAAG GTGCTGATGTTAGATGAGCCCACCTCAGGCATGGATGCAGTGTCCAGAAGGGCCATCTGGGACCTTCTCCAGCAGCAGAAGAGT

GACCGCACCGTCCTGCTGACCACTCACTTCATGGACGAAGCTGACCTGCTGGGAGACCGCATCGCCATCTTGGCCAAGGGGGAGCTCCAGTGCTGCGGGT

CTTCACTATTTCTCAAGCAGAAATACG GAGCTGGCTACCACATGACGCTGGTAAAAGAACCGCACTGCAATCCTGAAGGAATCTCTCAGCTGGTGCACC

ACCATGTCCCCAATGCCATGCTGGAGAGCCATGCTGGGGCTGAGCTGTCCTTTATTCTTCCCAAGGAGAGCACGCACAG GTTTGAAAGTCTGTTTGCTA

AACTGGAAAAGAAGCAGAAGGAGTTGGGCATCGCAAGCTTCGGGGCCTCGGTCACCACCATGGAGGAAGTCTTCCTTCG GGGCCGGAAGGGATTTGACA

TTGCCCTCAATTTGCTCATCGCCATGGCATTTCTGGCCAGCACCTTTTCCATCCTGGCTGTCAGTGAGAGGGCCGTCCAGGCCAAGCACGTTCAGTTTGT

GAGCGGTGTCCATGTGGCTACTTTCTGGTTCTCCGCTCTGTTGTGGGACCTCATCTCCTTCCTCGTTCCCAGTCTACTACTTCTG GTGGTGTTCCAAGC

CTTCAATGTGCACGCCTTCACGAGGGATGGTCACATGGCTGACCTGCTGCTGCTGCTCATGCTCTACGGCTGGGCCATCATCCCCCTCATGTACCTCATG

AGCTTCTTCTTCTCGGCTGCGTCCACAGCTTATACCAGGCTGACCATATTCAACATCCTGTCGGGCATCGCTACCTTCATCATGGTCACTATCATGCGTA

TCCCAG CTGTGAAGTTAGAAGAACTTTCCAGAACCTTAGATCATGTGTTCTTGGTGCTGCCAAACCACTGCCTGGGGATGGCGGTCAGCAACTTCTATG

AGAACTATGAGACTCGGCGATACTGCACTTCCTCAGAGCTTGCTGCCCACTACTGCAAGAAGTACA ACATCCAGTACCAGGAGAGCTTCTATGCCTGGA

GCACCCCAGGCGTGGGCAAGTTTGTGACTTCCATGGCTGCCTCAGGGGGCATCTACCTCACCCTGCTGTTCCTCATTGAGACCAACCTGCTGTGGCGACT

GAGAACCTTCATCTGTGCCTTCCGGAGGAGGTGGACTCTG GCAGAACTGCAGAACCGGACATCAGTGCTGCCCGAGGACCAGGATGTAGCTGAGGAGAG

GAGCCGAATCCTGGTCCCTAGCTTGGACTCCATGCTCGACACACCACTGATCATCAACGAGCTCTCCAAG GTGTATGACCAGCGAGCACCGCTCCTTGC

CGTGGACAGGATCTCCCTTGCGGTCCAGAAAGGGGAGTGCTTCGGCCTGTTGGGTTTCAATGGAGCTGGAAAAACCACAACATTCAAAATGCTGACTGGG

GAGGAGACCATCACCTCAGGGGATGCCTTTGTTGGTGGTTACAGCATCAGTTCTGACATCGGGAAG GTGCGGCAGCGGATGGGCTACTGCCCCCAGTTT

GATGCACTGCTTGATCACATGACTGGCAGGGAGATGCTGGTTATGTATGCACGGCTCCGAGGCATCCCAGAGCGGCTCATCAATGCCTGTGTGGAGAATA

CTCTGCGGGGTCTGCTGCTGGAACCGCACGCCAACAAACTAGTCAAGACTTACAG TGGTGGTAACAAACGCAAGCTAAGCACTGGCATTGCCCTCATTG

GAGAGCCTGCAGTCATCTTCCTGGATGAGCCATCGACCGGCATGGACCCAGTGGCCCGGCGTCTACTCTGGGATACTGTAGCCCGGGCCCGAGAGTCTGG

CAAAGCCATTGTCATCACCTCCCACAG TATGGAGGAGTGTGAAGCCTTATGTACCAGGCTGGCCATCATGGTACAGGGCCAGTTCAAGTGCCTGGGCAG

CCCACAGCACCTCAAGAGCAAGTTTGGCAGCGGCTACTCCCTGCAGGCCAAGGTCCGGAGCGAGGGGAAGCAAGACGCGCTAGAGGAGTTCAAGGCCTTT

GTGGACCTGACCTTCCCAG GCAGCATCCTAGAAGATGAGCACCAAGACATGGTCCATTATCATCTGCCTGGCTGTGACCTCAGCTGGGCCAAG GTATT

TGGTATCCTGGAGAAAGCCAAGGAGAAGTATGGAGTGGATGATTACTCTGTGAGCCAGATCTCCCTGGAGCAGGTCTTTCTGAGCTTTGCCCACCTACAA

CCCCCCACCACTGAGGATGGCCGGTGAGGAGCTCTGCTGCCTCCAGAGCACCAGGCGTGGAAGGGGCAAATCGTGCTTAGCCGTGCGTCCTCTCCCTCCC

AGTTTCTCCTTTCTTTCATTTTTAATCACTCTTTTCTATGATGGACATGAAAAACAATCAAGGTGATATGCACAAAGTGGACCATGTGTGTCTGTCAGTG

CCTGCAGGCAGGAGTCAGCATGCAGGTTTCCACTCCTGAAGTCAGGTCTCTGGAACCACAGTCCCAGACCCCATCCTGCTGTGCACACAGACAGGCCTTG

GTCCCAGCTGGTACTGCAGCTAGCCTGGGGGATTGAGCTTCTTTCCAGTGCTTATCCAGAGAGACCCCAGGGACCTGTCTATGTTTACATATGACACTAA

GCTCCCCTAGGGGGGGAAAGAAAGCCAACAGGGTTGAGCAGCAACAAGGACTTCCAGGCTGCCAGGAATGAGCAGCAAAGTTGCAAATACCTTCATGAAG

GGAAGATACTGGCTATGACTAGGTGCTGAGACCATTGGCTCCCAATGCAACTGCACAGGCATCCTTGGATGTCAATGTTCCTTCCAGTATGGACAGTGGA

CCGGGCTGATCTGATCCTGAGCCAGATGTCATCCCACAGAGCATCGGCAGCACAAGAGAGAGCTGTGGCCAGACTTGAAGCACATCCTCTGTTCCTAGCT

CTGTGCCTTCAAGAAGTCACTGGCCACAGGATTGTCAGGGACCACTACAGGGCTGAGTAGTGTCATCTCTTGAGGATACACTTAAACATATTGTGATTCT

ATAAAAAATAAAGGATAAGGGGACATGA
Translation
MAVLRQLTLLLWKNYTLK KRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATVYPDQSIQELPLFFSFPPPGGTWELAYVPSHSDAARTITETVKR

EFMIKMRV VHGFSSEKDFEDYIRYDNHSSSVLAAVVFEHSFNHSQDPLPLA VKYHLRFSYTRRNYMWTQTGNIFLKETEGWHTTSLFPLFPSPGPREP

SSPDGGEPG GYIREGFLAMQHAVDKAIMRYHANTSAQQLFQKLMVITKRFPFPPYISDPFLIAIQYQLPLLLMLSFTYTSLTIIRAVVQEKEKKLK EY

MRMMGLNSWLHWSAWFLMFFLFFLIVVSFMTLLFCVK VKKDIAVLSNSDPSLVLAFLLCFAISSISFSFMVSTFFSKA ANIAAAVGGFLYFFTYTPYF

FVAPRYNWMTLSQKLLSCLLSNVAMAMGAQLIGKFEAKG GTGIQWRDLLNPVNVDDNFCFGQVLGMLLLDSALYGLVTWYVEAVFPGQFGVPQPWHFFL

M PSYWCGNPRTVVGKEEEGSDPEKALRNEYFEAEPEDLVAGIKIKHLSK VFQVGNKDKMGIRDLTLNLYEGQITVLLGHNGAGKTTTMSLLTG GLFP

PTSGHAYIHGYEISQDMAQIRKSLGLCPQHDVLFDNLTVAEHLYFYAQ LKGLSLQKCPEEVKQMLHILSLEDKRDLRSKFLSGGMKRKLSIGIALIAGS

K VLMLDEPTSGMDAVSRRAIWDLLQQQKSDRTVLLTTHFMDEADLLGDRIAILAKGELQCCGSSLFLKQKYG GAGYHMTLVKEPHCNPEGISQLVHHH

VPNAMLESHAGAELSFILPKESTHR RFESLFAKLEKKQKELGIASFGASVTTMEEVFLR RGRKGFDIALNLLIAMAFLASTFSILAVSERAVQAKHVQ

FVSGVHVATFWFSALLWDLISFLVPSLLLL VVFQAFNVHAFTRDGHMADLLLLLMLYGWAIIPLMYLMSFFFSAASTAYTRLTIFNILSGIATFIMVTI

MRIPA AVKLEELSRTLDHVFLVLPNHCLGMAVSNFYENYETRRYCTSSELAAHYCKKYN NIQYQESFYAWSTPGVGKFVTSMAASGGIYLTLLFLIET

NLLWRLRTFICAFRRRWTL AELQNRTSVLPEDQDVAEERSRILVPSLDSMLDTPLIINELSK VYDQRAPLLAVDRISLAVQKGECFGLLGFNGAGKTT

TFKMLTGEETITSGDAFVGGYSISSDIGK VRQRMGYCPQFDALLDHMTGREMLVMYARLRGIPERLINACVENTLRGLLLEPHANKLVKTYS SGGNKR

KLSTGIALIGEPAVIFLDEPSTGMDPVARRLLWDTVARARESGKAIVITSHS SMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQAKVRSEG

KQDALEEFKAFVDLTFPG GSILEDEHQDMVHYHLPGCDLSWAK VFGILEKAKEKYGVDDYSVSQISLEQVFLSFAHLQPPTTEDGR
Transcript ENSMUST00000079594
Sequence
GCCCCCCCACCCCCTCCAGGAGCCGGAGCTTCCTGGTGCGTTCTTCCACCCGCGCCTGTCGCAGGCGCCTCCTCTCTGCCCCGCCGCCTCAGTTGTCAGC

TTCGGCCGCAACCGCCCCAGCAAGGCTGGAGCAGGACCGGGAGTCTAAGGGAGGGAACCTGGCGAGAGAGCTGCGCAGACCGCCGCCACCCTGGCGCTGA

GGGTCG - UNI16910 - GTGCCAGCACATCATGCCCGTGAGCCCCAGGTCCCTCCAGATGTCCCTGGAGATCTCAGCGTTCCTGCTCCCTAGGGCTG

TTGCTTCTGTCCAGGGGACCACTGGCTCCACCCCAGGGTCATCTGTGTAGAACTGCTGACGCCAGGCGACTTCACCCGTAGCCTTGCAGTGACACCTTCA

GCCAACCTTTCCTGGAACTAAG TTGTCCATCTTTAAGTCTTGATCTCTGGTTGGTGTTGGCACTGTGCCAGCAAGAAGATGGCAGTGCTGCGGCAGCTC

ACCCTCCTACTCTGGAAGAACTATACCCTGAAG AAACGGAAGGTTCTAGTGACAGTCCTGGAGCTCTTCCTGCCCCTGCTGTTTTCTGGGATCCTGATT

TGGCTTCGCTTGAAGATCCAGTCGGAGAATGTGCCCAATGCCACTGTTTACCCGGACCAGTCCATCCAGGAGCTGCCCCTGTTTTTCTCATTCCCTCCAC

CTGGGGGGACCTGGGAGCTCGCCTATGTCCCTTCCCACAGCGATGCTGCCAGGACCATCACGGAGACGGTGAAAAGGGAATTCATGATCAAGATGAGAG 

TGCACGGCTTCTCCTCTGAGAAGGACTTCGAGGACTACATTCGCTATGACAACCACTCCTCCAGCGTGCTGGCAGCTGTGGTATTTGAGCACAGCTTCAA

CCACAGCCAGGACCCCCTGCCGCTGGCG GTGAAATACCACCTGCGCTTCAGTTACACACGAAGAAATTACATGTGGACCCAAACAGGAAATATTTTCCT

AAAAGAGACTGAAGGCTGGCATACCACTTCACTTTTTCCACTTTTTCCAAGCCCCGGACCGCGGGAACCTTCATCACCTGATGGCGGTGAACCTG GATA

CATTCGGGAAGGCTTCCTGGCCATGCAACATGCTGTAGACAAAGCCATCATGCGTTACCATGCCAACACCTCTGCACAGCAGCTGTTCCAGAAGCTCATG

GTGATCACCAAAAGGTTCCCGTTCCCACCATACATCTCAGATCCATTCCTCATTGCCATCCAGTACCAGCTTCCTCTGCTGCTCATGCTGAGTTTCACCT

ACACCTCCCTCACCATCATCCGGGCTGTGGTGCAGGAGAAGGAGAAAAAACTAAAG GAGTACATGCGCATGATGGGGCTTAACAGCTGGCTACACTGGA

GCGCTTGGTTCCTCATGTTCTTCCTATTCTTCCTCATCGTGGTCTCCTTCATGACCCTCCTGTTCTGTGTCAAA GTGAAGAAGGACATAGCAGTCCTTT

CCAACAGCGACCCCTCCCTGGTCCTGGCGTTCCTGCTGTGTTTTGCAATCTCCTCCATTTCCTTCAGCTTCATGGTCAGCACCTTCTTCAGTAAAG CCA

ACATAGCAGCAGCCGTGGGTGGCTTCCTGTACTTCTTCACCTATACCCCCTACTTTTTCGTGGCTCCTCGGTACAACTGGATGACACTGAGTCAAAAGCT

CTTGTCCTGTCTCCTATCTAATGTTGCCATGGCAATGGGAGCCCAGCTCATAGGAAAATTCGAAGCCAAAG GCACTGGCATCCAGTGGCGGGACCTCCT

CAACCCTGTCAACGTGGACGACAATTTCTGCTTTGGACAAGTGCTGGGGATGCTGCTGCTGGACTCAGCACTCTATGGCCTGGTGACCTGGTACGTGGAG

GCTGTCTTCCCAGGCCAGTTTGGCGTACCCCAGCCCTGGCACTTCTTCCTTATG CCCTCCTACTGGTGTGGGAACCCAAGAACTGTCGTAGGGAAGGAA

GAGGAAGGCAGCGACCCAGAGAAAGCTCTCAGGAACGAGTACTTTGAAGCCGAGCCAGAGGACTTGGTAGCTGGAATCAAGATCAAGCATCTCTCCAAG 

GTGTTCCAAGTGGGCAATAAGGACAAGATGGGCATCAGAGACCTGACCCTGAACCTCTACGAAGGACAGATAACAGTCCTCCTGGGCCACAATGGTGCTG

GGAAGACCACGACCATGTCTCTGCTGACAG GCCTCTTCCCCCCTACCAGTGGACATGCTTATATTCATGGGTACGAAATTTCCCAAGACATGGCTCAGA

TCCGCAAGAGTTTGGGCCTGTGTCCCCAGCATGATGTACTGTTTGACAACCTGACAGTTGCCGAACATCTTTACTTCTATGCACAG CTGAAAGGCCTCT

CTCTCCAGAAGTGTCCTGAGGAAGTCAAGCAGATGCTACACATCCTCAGCCTGGAGGACAAGCGTGACTTACGGTCCAAGTTCCTGAGTGGGGGCATGAA

GCGCAAGCTCTCCATTGGCATCGCCCTCATAGCGGGCTCTAAG GTGCTGATGTTAGATGAGCCCACCTCAGGCATGGATGCAGTGTCCAGAAGGGCCAT

CTGGGACCTTCTCCAGCAGCAGAAGAGTGACCGCACCGTCCTGCTGACCACTCACTTCATGGACGAAGCTGACCTGCTGGGAGACCGCATCGCCATCTTG

GCCAAGGGGGAGCTCCAGTGCTGCGGGTCTTCACTATTTCTCAAGCAGAAATACG GAGCTGGCTACCACATGACGCTGGTAAAAGAACCGCACTGCAAT

CCTGAAGGAATCTCTCAGCTGGTGCACCACCATGTCCCCAATGCCATGCTGGAGAGCCATGCTGGGGCTGAGCTGTCCTTTATTCTTCCCAAGGAGAGCA

CGCACAG GTTTGAAAGTCTGTTTGCTAAACTGGAAAAGAAGCAGAAGGAGTTGGGCATCGCAAGCTTCGGGGCCTCGGTCACCACCATGGAGGAAGTCT

TCCTTCG GGTTGGTAAGCTGGTGGACACCAGCATGGACATTCAAGCCATTCAGCTTCCTGCTCTGCAGTACCAGCATGAGAGGCGGGCAAGCGACTGGG

CTTTGGACAGTAACCTGTGTGGGGTGATGGACCCAACGAATGGCATTGGAGCCCTCATAGAGGAAGAGGAAGTTTTGGTCAAGCTCAACACAGGG CTTG

CCCTCCACTGCCAGCAGTTCTGGGCCATGTTCCTGAAGAAGGCTGCATACAGCTGGCGGGAATGGAAGATGGTGGCAGCTCAGGTCCTGGTCCCCCTGAC

CTGCCTCACCCTGGCCCTCCTGGCTATCCACTACACCTCAGAGATCTTTGATGACCCTCTCCTGAAGCTAAGCCTGAACGAGTATGGTAGAACGGTTGTG

CCCTTCTCGGTCCCAGGCACATCCAGGCTGGCTCAGCAGCTGTCTGAGAATCTAAGGGACATGCTGCAGGCTGAGAGGCAGGAGCCCCGGGAAGTGCTAG

 GTGACCTAGAGGAGTTCCTGGTTTTCAGGGCCTCAGTGGAAGGAGGCGGCTTTAATGAGCGGTGCCTAGTAGCAACATCCTTCAAAGACAGAGGAGAGC

TGACCGTGGTCACTGCCCTGTTCAACAACCAGGCATACCACTCCCCAGCCACTGCCCTGGCCATCGTGGACAACCTTCTGTTCAAGCTATTGTGTGGCCC

TCAGGCCTCCATTGAGATCTCCAACTACCCCCAGCCCCGGAACACCCTGCAGGTCGCCAAGGACCACTTCAATGA GGGCCGGAAGGGATTTGACATTGC

CCTCAATTTGCTCATCGCCATGGCATTTCTGGCCAGCACCTTTTCCATCCTGGCTGTCAGTGAGAGGGCCGTCCAGGCCAAGCACGTTCAGTTTGTGAGC

GGTGTCCATGTGGCTACTTTCTGGTTCTCCGCTCTGTTGTGGGACCTCATCTCCTTCCTCGTTCCCAGTCTACTACTTCTG GTGGTGTTCCAAGCCTTC

AATGTGCACGCCTTCACGAGGGATGGTCACATGGCTGACCTGCTGCTGCTGCTCATGCTCTACGGCTGGGCCATCATCCCCCTCATGTACCTCATGAGCT

TCTTCTTCTCGGCTGCGTCCACAGCTTATACCAGGCTGACCATATTCAACATCCTGTCGGGCATCGCTACCTTCATCATGGTCACTATCATGCGTATCCC

AG CTGTGAAGTTAGAAGAACTTTCCAGAACCTTAGATCATGTGTTCTTGGTGCTGCCAAACCACTGCCTGGGGATGGCGGTCAGCAACTTCTATGAGAA

CTATGAGACTCGGCGATACTGCACTTCCTCAGAGCTTGCTGCCCACTACTGCAAGAAGTACA ACATCCAGTACCAGGAGAGCTTCTATGCCTGGAGCAC

CCCAGGCGTGGGCAAGTTTGTGACTTCCATGGCTGCCTCAGGGGGCATCTACCTCACCCTGCTGTTCCTCATTGAGACCAACCTGCTGTGGCGACTGAGA

ACCTTCATCTGTGCCTTCCGGAGGAGGTGGACTCTG GCAGAACTGCAGAACCGGACATCAGTGCTGCCCGAGGACCAGGATGTAGCTGAGGAGAGGAGC

CGAATCCTGGTCCCTAGCTTGGACTCCATGCTCGACACACCACTGATCATCAACGAGCTCTCCAAG GTGTATGACCAGCGAGCACCGCTCCTTGCCGTG

GACAGGATCTCCCTTGCGGTCCAGAAAGGGGAGTGCTTCGGCCTGTTGGGTTTCAATGGAGCTGGAAAAACCACAACATTCAAAATGCTGACTGGGGAGG

AGACCATCACCTCAGGGGATGCCTTTGTTGGTGGTTACAGCATCAGTTCTGACATCGGGAAG GTGCGGCAGCGGATGGGCTACTGCCCCCAGTTTGATG

CACTGCTTGATCACATGACTGGCAGGGAGATGCTGGTTATGTATGCACGGCTCCGAGGCATCCCAGAGCGGCTCATCAATGCCTGTGTGGAGAATACTCT

GCGGGGTCTGCTGCTGGAACCGCACGCCAACAAACTAGTCAAGACTTACAG TGGTGGTAACAAACGCAAGCTAAGCACTGGCATTGCCCTCATTGGAGA

GCCTGCAGTCATCTTCCTGGATGAGCCATCGACCGGCATGGACCCAGTGGCCCGGCGTCTACTCTGGGATACTGTAGCCCGGGCCCGAGAGTCTGGCAAA

GCCATTGTCATCACCTCCCACAG TATGGAGGAGTGTGAAGCCTTATGTACCAGGCTGGCCATCATGGTACAGGGCCAGTTCAAGTGCCTGGGCAGCCCA

CAGCACCTCAAGAGCAAGTTTGGCAGCGGCTACTCCCTGCAGGCCAAGGTCCGGAGCGAGGGGAAGCAAGACGCGCTAGAGGAGTTCAAGGCCTTTGTGG

ACCTGACCTTCCCAG GCAGCATCCTAGAAGATGAGCACCAAGACATGGTCCATTATCATCTGCCTGGCTGTGACCTCAGCTGGGCCAAG GTATTTGGT

ATCCTGGAGAAAGCCAAGGAGAAGTATGGAGTGGATGATTACTCTGTGAGCCAGATCTCCCTGGAGCAGGTCTTTCTGAGCTTTGCCCACCTACAACCCC

CCACCACTGAGGATGGCCGGTGAGGAGCTCTGCTGCCTCCAGAGCACCAGGCGTGGAAGGGGCAAATCGTGCTTAGCCGTGCGTCCTCTCCCTCCCAGTT

TCTCCTTTCTTTCATTTTTAATCACTCTTTTCTATGATGGACATGAAAAACAATCAAGGTGATATGCACAAAGTGGACCATGTGTGTCTGTCAGTGCCTG

CAGGCAGGAGTCAGCATGCAGGTTTCCACTCCTGAAGTCAGGTCTCTGGAACCACAGTCCCAGACCCCATCCTGCTGTGCACACAGACAGGCCTTGGTCC

CAGCTGGTACTGCAGCTAGCCTGGGGGATTGAGCTTCTTTCCAGTGCTTATCCAGAGAGACCCCAGGGACCTGTCTATGTTTACATATGACACTAAGCTC

CCCTAGGGGGGGAAAGAAAGCCAACAGGGTTGAGCAGCAACAAGGACTTCCAGGCTGCCAGGAATGAGCAGCAAAGTTGCAAATACCTTCATGAAGGGAA

GATACTGGCTATGACTAGGTGCTGAGACCATTGGCTCCCAATGCAACTGCACAGGCATCCTTGGATGTCAATGTTCCTTCCAGTATGGACAGTGGACCGG

GCTGATCTGATCCTGAGCCAGATGTCATCCCACAGAGCATCGGCAGCACAAGAGAGAGCTGTGGCCAGACTTGAAGCACATCCTCTGTTCCTAGCTCTGT

GCCTTCAAGAAGTCACTGGCCACAGGATTGTCAGGGACCACTACAGGGCTGAGTAGTGTCATCTCTTGAGGATACACTTAAACATATTGTGATTCTATAA

AAAATAAAGGATAAGGGGACATGA
Translation
 - UNI16910 -  MAVLRQLTLLLWKNYTLK KRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATVYPDQSIQELPLFFSFPPPGGTWELAYVP

SHSDAARTITETVKREFMIKMRV VHGFSSEKDFEDYIRYDNHSSSVLAAVVFEHSFNHSQDPLPLA VKYHLRFSYTRRNYMWTQTGNIFLKETEGWHT

TSLFPLFPSPGPREPSSPDGGEPG GYIREGFLAMQHAVDKAIMRYHANTSAQQLFQKLMVITKRFPFPPYISDPFLIAIQYQLPLLLMLSFTYTSLTII

RAVVQEKEKKLK EYMRMMGLNSWLHWSAWFLMFFLFFLIVVSFMTLLFCVK VKKDIAVLSNSDPSLVLAFLLCFAISSISFSFMVSTFFSKA ANIAA

AVGGFLYFFTYTPYFFVAPRYNWMTLSQKLLSCLLSNVAMAMGAQLIGKFEAKG GTGIQWRDLLNPVNVDDNFCFGQVLGMLLLDSALYGLVTWYVEAV

FPGQFGVPQPWHFFLM PSYWCGNPRTVVGKEEEGSDPEKALRNEYFEAEPEDLVAGIKIKHLSK VFQVGNKDKMGIRDLTLNLYEGQITVLLGHNGAG

KTTTMSLLTG GLFPPTSGHAYIHGYEISQDMAQIRKSLGLCPQHDVLFDNLTVAEHLYFYAQ LKGLSLQKCPEEVKQMLHILSLEDKRDLRSKFLSGG

MKRKLSIGIALIAGSK VLMLDEPTSGMDAVSRRAIWDLLQQQKSDRTVLLTTHFMDEADLLGDRIAILAKGELQCCGSSLFLKQKYG GAGYHMTLVKE

PHCNPEGISQLVHHHVPNAMLESHAGAELSFILPKESTHR RFESLFAKLEKKQKELGIASFGASVTTMEEVFLR RVGKLVDTSMDIQAIQLPALQYQH

ERRASDWALDSNLCGVMDPTNGIGALIEEEEVLVKLNTG LALHCQQFWAMFLKKAAYSWREWKMVAAQVLVPLTCLTLALLAIHYTSEIFDDPLLKLSL

NEYGRTVVPFSVPGTSRLAQQLSENLRDMLQAERQEPREVLG GDLEEFLVFRASVEGGGFNERCLVATSFKDRGELTVVTALFNNQAYHSPATALAIVD

NLLFKLLCGPQASIEISNYPQPRNTLQVAKDHFNE EGRKGFDIALNLLIAMAFLASTFSILAVSERAVQAKHVQFVSGVHVATFWFSALLWDLISFLVP

SLLLL VVFQAFNVHAFTRDGHMADLLLLLMLYGWAIIPLMYLMSFFFSAASTAYTRLTIFNILSGIATFIMVTIMRIPA AVKLEELSRTLDHVFLVLP

NHCLGMAVSNFYENYETRRYCTSSELAAHYCKKYN NIQYQESFYAWSTPGVGKFVTSMAASGGIYLTLLFLIETNLLWRLRTFICAFRRRWTL AELQN

RTSVLPEDQDVAEERSRILVPSLDSMLDTPLIINELSK VYDQRAPLLAVDRISLAVQKGECFGLLGFNGAGKTTTFKMLTGEETITSGDAFVGGYSISS

DIGK VRQRMGYCPQFDALLDHMTGREMLVMYARLRGIPERLINACVENTLRGLLLEPHANKLVKTYS SGGNKRKLSTGIALIGEPAVIFLDEPSTGMD

PVARRLLWDTVARARESGKAIVITSHS SMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQAKVRSEGKQDALEEFKAFVDLTFPG GSILED

EHQDMVHYHLPGCDLSWAK VFGILEKAKEKYGVDDYSVSQISLEQVFLSFAHLQPPTTEDGR
Transcript ENSMUST00000039013
Sequence
GCCCCCCCACCCCCTCCAGGAGCCGGAGCTTCCTGGTGCGTTCTTCCACCCGCGCCTGTCGCAGGCGCCTCCTCTCTGCCCCGCCGCCTCAGTTGTCAGC

TTCGGCCGCAACCGCCCCAGCAAGGCTGGAGCAGGACCGGGAGTCTAAGGGAGGGAACCTGGCGAGAGAGCTGCGCAGACCGCCGCCACCCTGGCGCTGA

GGGTCG - UNI16910 - AGAATACAAGAAAATTGCTCACTATCCCTCCACTGTGATGTACTGTCTTGTTCATTCTGCTTGGAAACAACTG GTGCCA

GCACATCATGCCCGTGAGCCCCAGGTCCCTCCAGATGTCCCTGGAGATCTCAGCGTTCCTGCTCCCTAGGGCTGTTGCTTCTGTCCAGGGGACCACTGGC

TCCACCCCAGGGTCATCTGTGTAGAACTGCTGACGCCAGGCGACTTCACCCGTAGCCTTGCAGTGACACCTTCAGCCAACCTTTCCTGGAACTAAG TTG

TCCATCTTTAAGTCTTGATCTCTGGTTGGTGTTGGCACTGTGCCAGCAAGAAGATGGCAGTGCTGCGGCAGCTCACCCTCCTACTCTGGAAGAACTATAC

CCTGAAG AAACGGAAGGTTCTAGTGACAGTCCTGGAGCTCTTCCTGCCCCTGCTGTTTTCTGGGATCCTGATTTGGCTTCGCTTGAAGATCCAGTCGGA

GAATGTGCCCAATGCCACTGTTTACCCGGACCAGTCCATCCAGGAGCTGCCCCTGTTTTTCTCATTCCCTCCACCTGGGGGGACCTGGGAGCTCGCCTAT

GTCCCTTCCCACAGCGATGCTGCCAGGACCATCACGGAGACGGTGAAAAGGGAATTCATGATCAAGATGAGAG TGCACGGCTTCTCCTCTGAGAAGGAC

TTCGAGGACTACATTCGCTATGACAACCACTCCTCCAGCGTGCTGGCAGCTGTGGTATTTGAGCACAGCTTCAACCACAGCCAGGACCCCCTGCCGCTGG

CG GTGAAATACCACCTGCGCTTCAGTTACACACGAAGAAATTACATGTGGACCCAAACAGGAAATATTTTCCTAAAAGAGACTGAAGGCTGGCATACCA

CTTCACTTTTTCCACTTTTTCCAAGCCCCGGACCGCGGGAACCTTCATCACCTGATGGCGGTGAACCTG GATACATTCGGGAAGGCTTCCTGGCCATGC

AACATGCTGTAGACAAAGCCATCATGCGTTACCATGCCAACACCTCTGCACAGCAGCTGTTCCAGAAGCTCATGGTGATCACCAAAAGGTTCCCGTTCCC

ACCATACATCTCAGATCCATTCCTCATTGCCATCCAGTACCAGCTTCCTCTGCTGCTCATGCTGAGTTTCACCTACACCTCCCTCACCATCATCCGGGCT

GTGGTGCAGGAGAAGGAGAAAAAACTAAAG GAGTACATGCGCATGATGGGGCTTAACAGCTGGCTACACTGGAGCGCTTGGTTCCTCATGTTCTTCCTA

TTCTTCCTCATCGTGGTCTCCTTCATGACCCTCCTGTTCTGTGTCAAA GTGAAGAAGGACATAGCAGTCCTTTCCAACAGCGACCCCTCCCTGGTCCTG

GCGTTCCTGCTGTGTTTTGCAATCTCCTCCATTTCCTTCAGCTTCATGGTCAGCACCTTCTTCAGTAAAG CCAACATAGCAGCAGCCGTGGGTGGCTTC

CTGTACTTCTTCACCTATACCCCCTACTTTTTCGTGGCTCCTCGGTACAACTGGATGACACTGAGTCAAAAGCTCTTGTCCTGTCTCCTATCTAATGTTG

CCATGGCAATGGGAGCCCAGCTCATAGGAAAATTCGAAGCCAAAG GCACTGGCATCCAGTGGCGGGACCTCCTCAACCCTGTCAACGTGGACGACAATT

TCTGCTTTGGACAAGTGCTGGGGATGCTGCTGCTGGACTCAGCACTCTATGGCCTGGTGACCTGGTACGTGGAGGCTGTCTTCCCAGGCCAGTTTGGCGT

ACCCCAGCCCTGGCACTTCTTCCTTATG CCCTCCTACTGGTGTGGGAACCCAAGAACTGTCGTAGGGAAGGAAGAGGAAGGCAGCGACCCAGAGAAAGC

TCTCAGGAACGAGTACTTTGAAGCCGAGCCAGAGGACTTGGTAGCTGGAATCAAGATCAAGCATCTCTCCAAG GTGTTCCAAGTGGGCAATAAGGACAA

GATGGGCATCAGAGACCTGACCCTGAACCTCTACGAAGGACAGATAACAGTCCTCCTGGGCCACAATGGTGCTGGGAAGACCACGACCATGTCTCTGCTG

ACAG GCCTCTTCCCCCCTACCAGTGGACATGCTTATATTCATGGGTACGAAATTTCCCAAGACATGGCTCAGATCCGCAAGAGTTTGGGCCTGTGTCCC

CAGCATGATGTACTGTTTGACAACCTGACAGTTGCCGAACATCTTTACTTCTATGCACAG CTGAAAGGCCTCTCTCTCCAGAAGTGTCCTGAGGAAGTC

AAGCAGATGCTACACATCCTCAGCCTGGAGGACAAGCGTGACTTACGGTCCAAGTTCCTGAGTGGGGGCATGAAGCGCAAGCTCTCCATTGGCATCGCCC

TCATAGCGGGCTCTAAG GTGCTGATGTTAGATGAGCCCACCTCAGGCATGGATGCAGTGTCCAGAAGGGCCATCTGGGACCTTCTCCAGCAGCAGAAGA

GTGACCGCACCGTCCTGCTGACCACTCACTTCATGGACGAAGCTGACCTGCTGGGAGACCGCATCGCCATCTTGGCCAAGGGGGAGCTCCAGTGCTGCGG

GTCTTCACTATTTCTCAAGCAGAAATACG GAGCTGGCTACCACATGACGCTGGTAAAAGAACCGCACTGCAATCCTGAAGGAATCTCTCAGCTGGTGCA

CCACCATGTCCCCAATGCCATGCTGGAGAGCCATGCTGGGGCTGAGCTGTCCTTTATTCTTCCCAAGGAGAGCACGCACAG GTTTGAAAGTCTGTTTGC

TAAACTGGAAAAGAAGCAGAAGGAGTTGGGCATCGCAAGCTTCGGGGCCTCGGTCACCACCATGGAGGAAGTCTTCCTTCG GGTTGGTAAGCTGGTGGA

CACCAGCATGGACATTCAAGCCATTCAGCTTCCTGCTCTGCAGTACCAGCATGAGAGGCGGGCAAGCGACTGGGCTTTGGACAGTAACCTGTGTGGGGTG

ATGGACCCAACGAATGGCATTGGAGCCCTCATAGAGGAAGAGGAAGTTTTGGTCAAGCTCAACACAGGG CTTGCCCTCCACTGCCAGCAGTTCTGGGCC

ATGTTCCTGAAGAAGGCTGCATACAGCTGGCGGGAATGGAAGATGGTGGCAGCTCAGGTCCTGGTCCCCCTGACCTGCCTCACCCTGGCCCTCCTGGCTA

TCCACTACACCTCAGAGATCTTTGATGACCCTCTCCTGAAGCTAAGCCTGAACGAGTATGGTAGAACGGTTGTGCCCTTCTCGGTCCCAGGCACATCCAG

GCTGGCTCAGCAGCTGTCTGAGAATCTAAGGGACATGCTGCAGGCTGAGAGGCAGGAGCCCCGGGAAGTGCTAG GTGACCTAGAGGAGTTCCTGGTTTT

CAGGGCCTCAGTGGAAGGAGGCGGCTTTAATGAGCGGTGCCTAGTAGCAACATCCTTCAAAGACAGAGGAGAGCTGACCGTGGTCACTGCCCTGTTCAAC

AACCAGGCATACCACTCCCCAGCCACTGCCCTGGCCATCGTGGACAACCTTCTGTTCAAGCTATTGTGTGGCCCTCAGGCCTCCATTGAGATCTCCAACT

ACCCCCAGCCCCGGAACACCCTGCAGGTCGCCAAGGACCACTTCAATGA GGGCCGGAAGGGATTTGACATTGCCCTCAATTTGCTCATCGCCATGGCAT

TTCTGGCCAGCACCTTTTCCATCCTGGCTGTCAGTGAGAGGGCCGTCCAGGCCAAGCACGTTCAGTTTGTGAGCGGTGTCCATGTGGCTACTTTCTGGTT

CTCCGCTCTGTTGTGGGACCTCATCTCCTTCCTCGTTCCCAGTCTACTACTTCTG GTGGTGTTCCAAGCCTTCAATGTGCACGCCTTCACGAGGGATGG

TCACATGGCTGACCTGCTGCTGCTGCTCATGCTCTACGGCTGGGCCATCATCCCCCTCATGTACCTCATGAGCTTCTTCTTCTCGGCTGCGTCCACAGCT

TATACCAGGCTGACCATATTCAACATCCTGTCGGGCATCGCTACCTTCATCATGGTCACTATCATGCGTATCCCAG CTGTGAAGTTAGAAGAACTTTCC

AGAACCTTAGATCATGTGTTCTTGGTGCTGCCAAACCACTGCCTGGGGATGGCGGTCAGCAACTTCTATGAGAACTATGAGACTCGGCGATACTGCACTT

CCTCAGAGCTTGCTGCCCACTACTGCAAGAAGTACA ACATCCAGTACCAGGAGAGCTTCTATGCCTGGAGCACCCCAGGCGTGGGCAAGTTTGTGACTT

CCATGGCTGCCTCAGGGGGCATCTACCTCACCCTGCTGTTCCTCATTGAGACCAACCTGCTGTGGCGACTGAGAACCTTCATCTGTGCCTTCCGGAGGAG

GTGGACTCTG GCAGAACTGCAGAACCGGACATCAGTGCTGCCCGAGGACCAGGATGTAGCTGAGGAGAGGAGCCGAATCCTGGTCCCTAGCTTGGACTC

CATGCTCGACACACCACTGATCATCAACGAGCTCTCCAAG GTGTATGACCAGCGAGCACCGCTCCTTGCCGTGGACAGGATCTCCCTTGCGGTCCAGAA

AGGGGAGTGCTTCGGCCTGTTGGGTTTCAATGGAGCTGGAAAAACCACAACATTCAAAATGCTGACTGGGGAGGAGACCATCACCTCAGGGGATGCCTTT

GTTGGTGGTTACAGCATCAGTTCTGACATCGGGAAG GTGCGGCAGCGGATGGGCTACTGCCCCCAGTTTGATGCACTGCTTGATCACATGACTGGCAGG

GAGATGCTGGTTATGTATGCACGGCTCCGAGGCATCCCAGAGCGGCTCATCAATGCCTGTGTGGAGAATACTCTGCGGGGTCTGCTGCTGGAACCGCACG

CCAACAAACTAGTCAAGACTTACAG TGGTGGTAACAAACGCAAGCTAAGCACTGGCATTGCCCTCATTGGAGAGCCTGCAGTCATCTTCCTGGATGAGC

CATCGACCGGCATGGACCCAGTGGCCCGGCGTCTACTCTGGGATACTGTAGCCCGGGCCCGAGAGTCTGGCAAAGCCATTGTCATCACCTCCCACAG TA

TGGAGGAGTGTGAAGCCTTATGTACCAGGCTGGCCATCATGGTACAGGGCCAGTTCAAGTGCCTGGGCAGCCCACAGCACCTCAAGAGCAAGTTTGGCAG

CGGCTACTCCCTGCAGGCCAAGGTCCGGAGCGAGGGGAAGCAAGACGCGCTAGAGGAGTTCAAGGCCTTTGTGGACCTGACCTTCCCAG GCAGCATCCT

AGAAGATGAGCACCAAGACATGGTCCATTATCATCTGCCTGGCTGTGACCTCAGCTGGGCCAAG GTATTTGGTATCCTGGAGAAAGCCAAGGAGAAGTA

TGGAGTGGATGATTACTCTGTGAGCCAGATCTCCCTGGAGCAGGTCTTTCTGAGCTTTGCCCACCTACAACCCCCCACCACTGAGGATGGCCGGTGAGGA

GCTCTGCTGCCTCCAGAGCACCAGGCGTGGAAGGGGCAAATCGTGCTTAGCCGTGCGTCCTCTCCCTCCCAGTTTCTCCTTTCTTTCATTTTTAATCACT

CTTTTCTATGATGGACATGAAAAACAATCAAGGTGATATGCACAAAGTGGACCATGTGTGTCTGTCAGTGCCTGCAGGCAGGAGTCAGCATGCAGGTTTC

CACTCCTGAAGTCAGGTCTCTGGAACCACAGTCCCAGACCCCATCCTGCTGTGCACACAGACAGGCCTTGGTCCCAGCTGGTACTGCAGCTAGCCTGGGG

GATTGAGCTTCTTTCCAGTGCTTATCCAGAGAGACCCCAGGGACCTGTCTATGTTTACATATGACACTAAGCTCCCCTAGGGGGGGAAAGAAAGCCAACA

GGGTTGAGCAGCAACAAGGACTTCCAGGCTGCCAGGAATGAGCAGCAAAGTTGCAAATACCTTCATGAAGGGAAGATACTGGCTATGACTAGGTGCTGAG

ACCATTGGCTCCCAATGCAACTGCACAGGCATCCTTGGATGTCAATGTTCCTTCCAGTATGGACAGTGGACCGGGCTGATCTGATCCTGAGCCAGATGTC

ATCCCACAGAGCATCGGCAGCACAAGAGAGAGCTGTGGCCAGACTTGAAGCACATCCTCTGTTCCTAGCTCTGTGCCTTCAAGAAGTCACTGGCCACAGG

ATTGTCAGGGACCACTACAGGGCTGAGTAGTGTCATCTCTTGAGGATACACTTAAACATATTGTGATTCTATAAAAAATAAAGGATAAGGGGACATGA
Translation
 - UNI16910 -   MAVLRQLTLLLWKNYTLK KRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATVYPDQSIQELPLFFSFPPPGGTWELAYV

PSHSDAARTITETVKREFMIKMRV VHGFSSEKDFEDYIRYDNHSSSVLAAVVFEHSFNHSQDPLPLA VKYHLRFSYTRRNYMWTQTGNIFLKETEGWH

TTSLFPLFPSPGPREPSSPDGGEPG GYIREGFLAMQHAVDKAIMRYHANTSAQQLFQKLMVITKRFPFPPYISDPFLIAIQYQLPLLLMLSFTYTSLTI

IRAVVQEKEKKLK EYMRMMGLNSWLHWSAWFLMFFLFFLIVVSFMTLLFCVK VKKDIAVLSNSDPSLVLAFLLCFAISSISFSFMVSTFFSKA ANIA

AAVGGFLYFFTYTPYFFVAPRYNWMTLSQKLLSCLLSNVAMAMGAQLIGKFEAKG GTGIQWRDLLNPVNVDDNFCFGQVLGMLLLDSALYGLVTWYVEA

VFPGQFGVPQPWHFFLM PSYWCGNPRTVVGKEEEGSDPEKALRNEYFEAEPEDLVAGIKIKHLSK VFQVGNKDKMGIRDLTLNLYEGQITVLLGHNGA

GKTTTMSLLTG GLFPPTSGHAYIHGYEISQDMAQIRKSLGLCPQHDVLFDNLTVAEHLYFYAQ LKGLSLQKCPEEVKQMLHILSLEDKRDLRSKFLSG

GMKRKLSIGIALIAGSK VLMLDEPTSGMDAVSRRAIWDLLQQQKSDRTVLLTTHFMDEADLLGDRIAILAKGELQCCGSSLFLKQKYG GAGYHMTLVK

EPHCNPEGISQLVHHHVPNAMLESHAGAELSFILPKESTHR RFESLFAKLEKKQKELGIASFGASVTTMEEVFLR RVGKLVDTSMDIQAIQLPALQYQ

HERRASDWALDSNLCGVMDPTNGIGALIEEEEVLVKLNTG LALHCQQFWAMFLKKAAYSWREWKMVAAQVLVPLTCLTLALLAIHYTSEIFDDPLLKLS

LNEYGRTVVPFSVPGTSRLAQQLSENLRDMLQAERQEPREVLG GDLEEFLVFRASVEGGGFNERCLVATSFKDRGELTVVTALFNNQAYHSPATALAIV

DNLLFKLLCGPQASIEISNYPQPRNTLQVAKDHFNE EGRKGFDIALNLLIAMAFLASTFSILAVSERAVQAKHVQFVSGVHVATFWFSALLWDLISFLV

PSLLLL VVFQAFNVHAFTRDGHMADLLLLLMLYGWAIIPLMYLMSFFFSAASTAYTRLTIFNILSGIATFIMVTIMRIPA AVKLEELSRTLDHVFLVL

PNHCLGMAVSNFYENYETRRYCTSSELAAHYCKKYN NIQYQESFYAWSTPGVGKFVTSMAASGGIYLTLLFLIETNLLWRLRTFICAFRRRWTL AELQ

NRTSVLPEDQDVAEERSRILVPSLDSMLDTPLIINELSK VYDQRAPLLAVDRISLAVQKGECFGLLGFNGAGKTTTFKMLTGEETITSGDAFVGGYSIS

SDIGK VRQRMGYCPQFDALLDHMTGREMLVMYARLRGIPERLINACVENTLRGLLLEPHANKLVKTYS SGGNKRKLSTGIALIGEPAVIFLDEPSTGM

DPVARRLLWDTVARARESGKAIVITSHS SMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQAKVRSEGKQDALEEFKAFVDLTFPG GSILE

DEHQDMVHYHLPGCDLSWAK VFGILEKAKEKYGVDDYSVSQISLEQVFLSFAHLQPPTTEDGR

For any suggestions or comments, please send an email to unitrap@crg.es