Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024135 (Srbd1)
Chromosomal location
Chr 17: 86384006 - 86544515 (-)
Description
S1 RNA binding domain 1 Gene [Source:MGI Symbol;Acc:MGI:1925836]
UniGene
Mm.405015 Mm.410450 
MGI
MGI:1925836 
Uniprot/SWISSPROT
Q497V5 
Uniprot/SPTREMBL
Q9CRK2 Q8CHZ0 
Human Ortholog
ENSG00000068784 (SRBD1)
Omim not available
UniTrap UNI14379
Vector Insertion
Chr 17: 86541699 - 86544516
Public Clones 5SD174C01 (ggtc) 3SD174C01 (ggtc) FHCRC-GT-S16-10F1 (fhcrc)
Private Clones OST232910 (lexicon) OST195244 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26233
Vector Insertion
Chr 17: 86538590 - 86541699
Public Clones not available
Private Clones OST129322 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26693
Vector Insertion
Chr 17: 86535503 - 86535876
Public Clones not available
Private Clones OST103158 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5909
Vector Insertion
Chr 17: 86520087 - 86525450
Public Clones CSH114 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4914
Vector Insertion
Chr 17: 86514637 - 86519253
Public Clones AR0079 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27172
Vector Insertion
Chr 17: 86502341 - 86508566
Public Clones not available
Private Clones OST67893 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5558
Vector Insertion
Chr 17: 86457108 - 86497851
Public Clones YTA202 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3421
Vector Insertion
Chr 17: 86450425 - 86450509
Public Clones AB0022 (sanger) RRU047 (baygenomics) RRS330 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024951
Sequence
GGAACCGGAAGATTCCTCAGCAGAACTCTCTTCTCCAGATTCGCCAAGCCCGAAG - UNI14379 - ATGCCCTCATTGCGCAAAAGAGTGAAAATAC

AGGCCGAGAATGCAGAACCCAAAGATGAATGCTCTTTCTTCTCTGAGTT - UNI14379 - - UNI26233 - GTCATCTGGCTCTGAAGAAGATAA

CAAGGAAGACAGCATTTGGGAACCTCAGAAGAAAGTTCCCAGAAATCGTAGACAGCCTGCTTCCAAGGGATCCAAACGGAAGCAGGGGCCCAGGGCGAAG

AAGAGCTCCCAACAGGTGGATGACGAATCAAAAGATGTGGCTGTTAAGGAGGAGTTG - UNI26693 - AACAGCCCGGTGGCTATTGTTGATGCAGA

TTTGGAAGAGAAAAGCCACAAGTTGCAGACGACAAAGACTCTTAAAACTGCAGCAAAAAAG
Translation
 - UNI14379 - MPSLRKRVKIQAENAEPKDECSFFSEL - UNI14379 - - UNI26233 - LSSGSEEDNKEDSIWEPQKKVPRNRRQPASKG

SKRKQGPRAKKSSQQVDDESKDVAVKEEL - UNI26693 - NSPVAIVDADLEEKSHKLQTTKTLKTAAKK
Transcript ENSMUST00000095187
Sequence
AAACAGGAGTACAACATATTTTAGCAGACATGATTGCTAAAGACAAAGATACGCTTGACTTTATTCGGGGCTT GTGTAAACATAGATACATTTGTATCC

AGTCATCTCTTGCAAAAGTATCCTCAAAAAAAGTAAATGAGAAGGAAGTTGATAAGTTTCAGCTTTACCAGAATTTCTCCTGCAACATAAGGACCATCCA

CCATCACCAG - UNI4914 - ATTCTGGCCATTAACCGAGGAGAGAATTTGAAGATCCTGACCGTCAAAGTCAACATTTCTGATGGAGTAAAGAACGA

ATTCTGTCGATGGTGTATACAGAACAG GTGGAGGCCACGTGGCTTTGCACGGCCAGAGTTGATGAAGATCTTACATAATTCACTGGATGACTCCTTTAA

GCGCCTCATTGTTCCTCTCCTCTGTAGAGAGTTCAG - UNI27172 - AGCCAAACTGACATCAGATGCAGAGAAGCAATCAGTAATGATGTTTGGAC

AGAACCTCCGCCAGCTCCTTTTAACAAGTCCTGTGCCAGGCCGCACCCTGATGGGAGTAGATCCTGGCTACAAACATGGATGCAAACTAGCCATCATTTC

TCCTACTA GTCAGATCCTTCACACGGATGTGGTTTACTTGCACTGTGGACAAGGCTTCCGAGAGGCCGAGAAGATCAAGAGGCTTTTGCTGCATTTCAA

 CTGCAGAACAGTGGTGATCGGAAATGGAACTGCCTGCCGGGAAACTGAAGCCTACTTTGCTGACCTGATAATGAAAAATTACTTTGCACCACTGGATGT

CGTTTACTG - UNI5558 - CATCGTCAGTGAAGCAGGGGCCTCCATCTACAGTGTCAGCCCCGAAGCGAACAAGGAGATGCCAGGACTGGACCCTAA

CTTGAGAAGTGCAG - UNI3421 - TTTCCATAGCAAGGCGTGTTCAAGATCCATTAGCTGAGCTAGTGAAATTTGACCCGAAGCACATTGGAGTTGG

AATGTATCAG - UNI3421 - CATGATGTATCCCAGACATTACTCAAGGCAACACTGGACAGTGTTGTAGAAGAATGTGTCAGCTTTGTGGGAGTGGA

TATTAACATTTGTTCTGAGGTTTTGTTAAG GCATATTGCAGGACTCAATGCCAATAGAGCCAAAAATATTATTGAGTGGCGAGAGAAAAATGGCCCTTT

CATTAACCGAGAACAGTTGAAGAAGGTGAAAGGGCTTGGTCCAAAATCCTTCCAGCAGTGTGCTGGCTTCGTCAGGATCAACCAGGATTACATCCGGACA

TTCTGCAG TCAACACACTGACTCTTCAGGCCAGAGCCAGGAAACTGCCATGGTCACAAATGAGAAGCTGGGCAAAAAGAAGAACAAAGCAGATGCCACC

CTCATACCAAACCCACTGGACCAGACTTGCATCCATCCGGAATCCTATGACATAGCAGTCAG GTTTTTATCGTTCATTGGGGGGACAATGTGTGAGATT

GGAAAGCCTGAAATGCAGCAGAAAATAAACGTGTCTCTCGGGAAAGAAGGCATAGAGGAAACTGCTGAAAGGTTACAGACAACTGTGCACACACTGCAGG

TCATCATAGATGGACTGAGCCAGCCCAAAACCTTTGACATCCGAACAG ATTTTGATAAGCCTGACTTCAAGAGAAGCATAGTGTGTCTGGAAGACCTGC

AGGTTGGGACAGTTCTTACAGGCAAAGTGGAGAATGCTACTCTGTTTGGGGTCTTTGTGGATATAGGAGTGGGGAAGGCGGGGCTGATTCCTATCCGGTT

CATAACAGAAGCCAAGCTGTCCAAAACAAAGAGGAGAAGAAGCCTGGGCCTGGGCCCCGGAGAGAAAGTGGAGGTGAAAGTCCTCAATGTCGACATTCCC

CGATCTCGGATTTCGCTCGACCTCCTCCGGGTGTTGTGAGTGCCCCACCGAAGGCCAAACACCAATGTGTTCCCTCACTTCTACAGCCTGACAAGGACGA

GCCAGAGCTCATGGAACCTAGAGAGCGGGGGGGGGGGGGCTCCTGGGTAGAAGTGTTCATCACACTATCCTGACTCCCACGGAAAGCAACAGGAGACCTC

GCATGGTGTCCTACAGCAGCAGTTTCTGTCTTTGTAATTCCTTGTTGACCACATACAGCAGGCAGCTTCACGTCCTCCCGCTAACATCTGCTGCCTTAGA

CCTGGGTGGGATGTCTTGCTTATTTGAAATGTGTAGTGTTGATTGACACATTAAGACTAGCAGTCTTTAATCCTGCCACTTTATTGAGGTGTTATTAGCA

CTTTTGTTCATAATTCATAATTTTGTAATAATCTTTATTTTCCCTTAGCAAACCAAGTAAAAATAAACTAGTAAAAGATTATCATGTTTTATGACCATCA

ACGGAATCATTTTAATGTGTTCCTCAGAACGTATGTATTGACTTCTACAATAAATGACTGGCTGGTG
Translation
MIAKDKDTLDFIRGL LCKHRYICIQSSLAKVSSKKVNEKEVDKFQLYQNFSCNIRTIHHHQ - UNI4914 - ILAINRGENLKILTVKVNISDGVKN

EFCRWCIQNR RWRPRGFARPELMKILHNSLDDSFKRLIVPLLCREFR - UNI27172 - RAKLTSDAEKQSVMMFGQNLRQLLLTSPVPGRTLMGVD

PGYKHGCKLAIISPTS SQILHTDVVYLHCGQGFREAEKIKRLLLHFN NCRTVVIGNGTACRETEAYFADLIMKNYFAPLDVVYC - UNI5558 - C

IVSEAGASIYSVSPEANKEMPGLDPNLRSAV - UNI3421 - VSIARRVQDPLAELVKFDPKHIGVGMYQ - UNI3421 - HDVSQTLLKATLDSV

VEECVSFVGVDINICSEVLLR RHIAGLNANRAKNIIEWREKNGPFINREQLKKVKGLGPKSFQQCAGFVRINQDYIRTFCS SQHTDSSGQSQETAMVT

NEKLGKKKNKADATLIPNPLDQTCIHPESYDIAVR RFLSFIGGTMCEIGKPEMQQKINVSLGKEGIEETAERLQTTVHTLQVIIDGLSQPKTFDIRTD 

DFDKPDFKRSIVCLEDLQVGTVLTGKVENATLFGVFVDIGVGKAGLIPIRFITEAKLSKTKRRRSLGLGPGEKVEVKVLNVDIPRSRISLDLLRVL
Transcript ENSMUST00000043323
Sequence
ATGCCCTCATTGCGCAAAAGAGTGAAAATACAGGCCGAGAATGCAGAACCCAAAGATGAATGCTCTTTCTTCTCTGAGTT - UNI14379 - - UNI2

6233 - GTCATCTGGCTCTGAAGAAGATAACAAGGAAGACAGCATTTGGGAACCTCAGAAGAAAGTTCCCAGAAATCGTAGACAGCCTGCTTCCAAGGG

ATCCAAACGGAAGCAGGGGCCCAGGGCGAAGAAGAGCTCCCAACAGGTGGATGACGAATCAAAAGATGTGGCTGTTAAGGAGGAGTTG - UNI26693 

- AACAGCCCGGTGGCTATTGTTGATGCAGATTTGGAAGAGAAAAGCCACAAGTTGCAGACGACAAAGACTCTTAAAACTGCAGCAAAAAAGCAAAAAAA

ACCAGTTCCGAGGGCCAAAAAAAGGTTGAAAGTTGATGAGGAAACCAGCCAGGCCAGCCCCTTGGAGGGTGGAGGCAGTAATGTGGAGACCCCCTCAACA

AGCGCCTGTGGAAATGTGTGCAAGAAGGAGGAGAGCGAGGACAGCTTCACGTTTGGGCAGTCCCCGGTAAAGAGGATCAGGACTGAGTCATGTCCTCAGG

GGAGGCCGGCCAGGGTTCCCGACGGTGTCAGCGACATTAAAGAGGAGGTAGAAATGAACTGGGACGTAGTACAG - UNI26693 - GTTTTATCTGAG

AGAACTAATATTGAACCTTGGGTTTGTGCCAACATCATACGCCTCTTTAATGATGACAACACAATCCCCTTCATTGTACGCTATCGAAAAGAGCTCATTA

ATAACCTTGATGCTGATTTCTTAAGAGAAGTTCGTCAAACCCTAGATGAGCTACG GGATGTTGCCAAGAAGGTTCATAGTAGAATCCAGAAAATTAAGA

AGGAGGGGAAAATGTCGGAGTGCTTGCTGCAAGCCTTGTTGAACTGTAAAACGTTCGAGGAACTAGAGCATGTG TCTGCTCCATATAAAATGGGGAGCA

AGGGCACGAAAGCCCAGAGAGCAAAACAGTTGGGGCTAGAAGGAGCAGCGTGGACCCTGCTGGAGAACCCGGGGCAGCTCAACCTGCTGTCTTACATCAA

GCCTGATGTTAAAG - UNI5909 - GCCTTTCTGAGCTCAACGATATCGAAACAGGAGTACAACATATTTTAGCAGACATGATTGCTAAAGACAAAGA

TACGCTTGACTTTATTCGGGGCTT GTGTAAACATAGATACATTTGTATCCAGTCATCTCTTGCAAAAGTATCCTCAAAAAAAGTAAATGAGAAGGAAGT

TGATAAGTTTCAGCTTTACCAGAATTTCTCCTGCAACATAAGGACCATCCACCATCACCAG - UNI4914 - ATTCTGGCCATTAACCGAGGAGAGAA

TTTGAAGATCCTGACCGTCAAAGTCAACATTTCTGATGGAGTAAAGAACGAATTCTGTCGATGGTGTATACAGAACAG GTGGAGGCCACGTGGCTTTGC

ACGGCCAGAGTTGATGAAGATCTTACATAATTCACTGGATGACTCCTTTAAGCGCCTCATTGTTCCTCTCCTCTGTAGAGAGTTCAG - UNI27172 -

 AGCCAAACTGACATCAGATGCAGAGAAGCAATCAGTAATGATGTTTGGACAGAACCTCCGCCAGCTCCTTTTAACAAGTCCTGTGCCAGGCCGCACCCT

GATGGGAGTAGATCCTGGCTACAAACATGGATGCAAACTAGCCATCATTTCTCCTACTA GTCAGATCCTTCACACGGATGTGGTTTACTTGCACTGTGG

ACAAGGCTTCCGAGAGGCCGAGAAGATCAAGAGGCTTTTGCTGCATTTCAA CTGCAGAACAGTGGTGATCGGAAATGGAACTGCCTGCCGGGAAACTGA

AGCCTACTTTGCTGACCTGATAATGAAAAATTACTTTGCACCACTGGATGTCGTTTACTG - UNI5558 - CATCGTCAGTGAAGCAGGGGCCTCCAT

CTACAGTGTCAGCCCCGAAGCGAACAAGGAGATGCCAGGACTGGACCCTAACTTGAGAAGTGCAG - UNI3421 - TTTCCATAGCAAGGCGTGTTCA

AGATCCATTAGCTGAGCTAGTGAAATTTGACCCGAAGCACATTGGAGTTGGAATGTATCAGGTAAAGCAATGTGGATCGT GTTCAAAATGGAAAGAGGG

AGGGGTTTACAGGAAGAAATTCTGGTGTAGTGTTGTTGAAAGGGAGACCAGTTGTACAGAA CATGATGTATCCCAGACATTACTCAAGGCAACACTGGA

CAGTGTTGTAGAAGAATGTGTCAGCTTTGTGGGAGTGGATATTAACATTTGTTCTGAGGTTTTGTTAAG GCATATTGCAGGACTCAATGCCAATAGAGC

CAAAAATATTATTGAGTGGCGAGAGAAAAATGGCCCTTTCATTAACCGAGAACAGTTGAAGAAGGTGAAAGGGCTTGGTCCAAAATCCTTCCAGCAGTGT

GCTGGCTTCGTCAGGATCAACCAGGATTACATCCGGACATTCTGCAG TAGTCAACACACTGACTCTTCAGGCCAGAGCCAGGAAACTGCCATGGTCACA

AATGAGAAGCTGGGCAAAAAGAAGAACAAAGCAGATGCCACCCTCATACCAAACCCACTGGACCAGACTTGCATCCATCCGGAATCCTATGACATAGCAG

TCAG GTTTTTATCGTTCATTGGGGGGACAATGTGTGAGATTGGAAAGCCTGAAATGCAGCAGAAAATAAACGTGTCTCTCGGGAAAGAAGGCATAGAGG

AAACTGCTGAAAGGTTACAGACAACTGTGCACACACTGCAGGTCATCATAGATGGACTGAGCCAGCCCAAAACCTTTGACATCCGAACAG ATTTTGATA

AGCCTGACTTCAAGAGAAGCATAGTGTGTCTGGAAGACCTGCAGGTTGGGACAGTTCTTACAGGCAAAGTGGAGAATGCTACTCTGTTTGGGGTCTTTGT

GGATATAGGAGTGGGGAAGGCGGGGCTGATTCCTATCCGGTTCATAACAGAAGCCAAGCTGTCCAAAACAAAGAGGAGAAGAAGCCTGGGCCTGGGCCCC

GGAGAGAAAGTGGAGGTGAAAGTCCTCAATGTCGACATTCCCCGATCTCGGATTTCGCTCGACCTCCTCCGGGTGTTGTGAGTGCCCCACCGAAGGCCAA

ACACCAATGTGTTCCCTCACTTCTACAGCCTGACAAGGACGAGCCAGAGCTCATGGAACCTAGAGAGCGGGGGGGGGGGGGCTCCTGGGTAGAAGTGTTC

ATCACACTATCCTGACTCCCACGGAAAGCAACAGGAGACCTCGCATGGTGTCCTACAGCAGCAGTTTCTGTCTTTGTAATTCCTTGTTGACCACATACAG

CAGGCAGCTTCACGTCCTCCCGCTAACATCTGCTGCCTTAGACCTGGGTGGGATGTCTTGCTTATTTGAAATGTGTAGTGTTGATTGACACATTAAGACT

AGCAGTCTTTAATCCTGCCACTTTATTGAGGTGTTATTAGCACTTTTGTTCATAATTCATAATTTTGTAATAATCTTTATTTTCCCTTAGCAAACCAAGT

AAAAATAAACTAGTAAAAGATTATCATGTTTTATGACCATCAACGGAATCATTTTAATGTGTTCCTCAGAACGTATGTATTGACTTCTACAATAAATGAC

TGGCTGGTG
Translation
MPSLRKRVKIQAENAEPKDECSFFSEL - UNI14379 - - UNI26233 - LSSGSEEDNKEDSIWEPQKKVPRNRRQPASKGSKRKQGPRAKKSSQ

QVDDESKDVAVKEEL - UNI26693 - NSPVAIVDADLEEKSHKLQTTKTLKTAAKKQKKPVPRAKKRLKVDEETSQASPLEGGGSNVETPSTSACGN

VCKKEESEDSFTFGQSPVKRIRTESCPQGRPARVPDGVSDIKEEVEMNWDVVQ - UNI26693 - VLSERTNIEPWVCANIIRLFNDDNTIPFIVRYR

KELINNLDADFLREVRQTLDELR RDVAKKVHSRIQKIKKEGKMSECLLQALLNCKTFEELEHV SAPYKMGSKGTKAQRAKQLGLEGAAWTLLENPGQL

NLLSYIKPDVKG - UNI5909 - GLSELNDIETGVQHILADMIAKDKDTLDFIRGL LCKHRYICIQSSLAKVSSKKVNEKEVDKFQLYQNFSCNIRT

IHHHQ - UNI4914 - ILAINRGENLKILTVKVNISDGVKNEFCRWCIQNR RWRPRGFARPELMKILHNSLDDSFKRLIVPLLCREFR - UNI271

72 - RAKLTSDAEKQSVMMFGQNLRQLLLTSPVPGRTLMGVDPGYKHGCKLAIISPTS SQILHTDVVYLHCGQGFREAEKIKRLLLHFN NCRTVVIG

NGTACRETEAYFADLIMKNYFAPLDVVYC - UNI5558 - CIVSEAGASIYSVSPEANKEMPGLDPNLRSAV - UNI3421 - VSIARRVQDPLAE

LVKFDPKHIGVGMYQVKQCGSC CSKWKEGGVYRKKFWCSVVERETSCTE HDVSQTLLKATLDSVVEECVSFVGVDINICSEVLLR RHIAGLNANRAK

NIIEWREKNGPFINREQLKKVKGLGPKSFQQCAGFVRINQDYIRTFCS SSQHTDSSGQSQETAMVTNEKLGKKKNKADATLIPNPLDQTCIHPESYDIA

VR RFLSFIGGTMCEIGKPEMQQKINVSLGKEGIEETAERLQTTVHTLQVIIDGLSQPKTFDIRTD DFDKPDFKRSIVCLEDLQVGTVLTGKVENATLF

GVFVDIGVGKAGLIPIRFITEAKLSKTKRRRSLGLGPGEKVEVKVLNVDIPRSRISLDLLRVL

For any suggestions or comments, please send an email to unitrap@crg.es