Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024151 (Msh2)
Chromosomal location
Chr 17: 88071912 - 88123052 (+)
Description
mutS homolog 2 (E. coli) Gene [Source:MGI Symbol;Acc:MGI:101816]
RefSeq_dna
NM_008628 
RefSeq_peptide
NP_032654.1 
UniGene
Mm.4619 Mm.408729 Mm.452631 Mm.471165 
MGI
MGI:101816 
Uniprot/SWISSPROT
P43247 
Uniprot/SPTREMBL
Q3TZI5 Q80V79 
Human Ortholog
ENSG00000095002 (MSH2)
Omim 120435 - LYNCH SYNDROME I  158320 - MUIR-TORRE SYNDROME  608089 - ENDOMETRIAL CANCER  
UniTrap UNI13895
Vector Insertion
Chr 17: 88072147 - 88077547
Public Clones CMHD-GT_208F11-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13143
Vector Insertion
Chr 17: 88077703 - 88079139
Public Clones CMHD-GT_324C11-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12738
Vector Insertion
Chr 17: 88084927 - 88085635
Public Clones W024B04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12030
Vector Insertion
Chr 17: 88085770 - 88088281
Public Clones A062D03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5181
Vector Insertion
Chr 17: 88088482 - 88095834
Public Clones (sanger) YTC119 (baygenomics) HMA065 (baygenomics) XE048 (baygenomics)
IST14729F9 (tigm)
Private Clones OST467685 (lexicon) OST459917 (lexicon) OST426321 (lexicon) OST424089 (lexicon)
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4005
Vector Insertion
Chr 17: 88095945 - 88106521
Public Clones AR0057 (sanger) AH0078 (sanger) RRR339 (baygenomics) H001E06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37277
Vector Insertion
Chr 17: 88112067 - 88116794
Public Clones CMHD-GT_461G2-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7558
Vector Insertion
Chr 17: 88120399 - 88122670
Public Clones RRR291 (baygenomics) RRQ031 (baygenomics)
Private Clones OST7546 (lexicon) OST7505 (lexicon)
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024967
Sequence
GTGTTGGTGTGGAGCGGCTCGGAAATGGCGGTGCAGCCTAAGGAGACGCTGCAGTTGGAAGGCGCGGCCGAGGCGGGCTTCGTGCGCTTCTTTGAGGGCA

TGCCGGAGAAGCCGAGCACCACGGTGCGCCTCTTCGACCGCGGCGACTTTTACACGGCGCACGGAGAGGACGCGCTGCTGGCGGCCCGCGAGGTGTTCAA

GACCCAGGGCGTGATCAAGTACATGGGGCCGGCAG - UNI13895 - GGAGTAAGACCCTGCAGAGTGTTGTGCTTAGCAAGATGAACTTTGAGTCTT

TCGTGAAAGATCTTCTTCTGGTTCGCCAGTATCGAGTTGAAGTTTATAAGAATAAAGCTGGAAATAAGGCGTCTAAGGAGAATGAGTGGTATCTGGCATT

TAAG - UNI13143 - GCTTCTCCCGGCAATCTTTCTCAGTTTGAAGACATCCTGTTTGGTAACAATGACATGTCAGCTTCCGTTGGCGTTATGGGTA

TTAAAATGGCCGTGGTTGATGGTCAAAGACATGTTGGAGTTGGGTATGTGGATTCCACCCAGAGGAAGCTAGGCTTGTGTGAGTTCCCCGAGAATGATCA

GTTCTCCAATCTCGAGGCTCTTCTGATTCAGATTGGACCAAAGGAATGCGTTTTACCAGGAGGAGAGACTACTGGAGACATGGGGAAACTGAGGCAG GT

TATCCAGAGAGGAGGGATTCTGATCACAGAAAGAAAGAGAGCCGACTTTTCCACTAAAGACATTTATCAGGATCTCAACCGGTTACTGAAAGGCAAAAAA

GGAGAACAGATAAATAGTGCTGCCCTACCAGAGATGGAGAATCAG GTTGCAGTTTCATCACTATCTGCAGTAATCAAGTTTTTAGAACTCTTATCAGAC

GATTCAAATTTTGGGCAGTTTGAACTGGCCACTTTTGACTTCAGCCAGTACATGAAGTTGGACATGGCAGCAGTTAGAGCCCTCAACCTTTTCCAG - U

NI12738 - GGTTCTGTTGAAGACACCACTGGCTCTCAGTCTCTGGCCGCATTATTGAATAAATGCAAAACTGCTCAAGGACAAAGATTGGTTAACCAG

TGGATCAAGCAGCCGCTCATGGATAGGAACAGGATAGAGGAGAG - UNI12030 - GTTAAATTTAGTGGAAGCTTTTGTCGAGGATTCAGAACTGAG

GCAGAGTTTACAGGAGGATTTGCTTCGCCGGTTTCCAGACCTTAACCGGCTTGCCAAGAAATTCCAGAGACAAGCAGCGAATTTACAAGACTGTTACCGA

CTGTATCAGGGTATTAACCAGCTCCCCAGCGTCATCCAGGCTCTGGAGAAATACGAAG - UNI5181 - GAAGACACCAGGCACTGTTGTTGGCAGTT

TTTGTGACTCCTCTTATTGATCTTCGTTCTGATTTTTCAAAATTTCAAGAAATGATAGAAACAACTTTAGATATGGATCAG - UNI4005 - GTGGAA

AACCACGAGTTCCTTGTAAAACCTTCATTTGATCCTAACCTGAGTGAACTAAGAGAAGTCATGGATGGCCTGGAGAAGAAGATGCAGTCCACCTTAATAA

ATGCAGCCCGGGGGCTCG GATTGGATCCTGGCAAACAGATTAAATTGGACTCCAGTGCACAGTTTGGATATTATTTCCGTGTAACCTGCAAGGAAGAGA

AAGTGCTTCGCAACAACAAGAACTTCAGCACAGTGGACATCCAGAAGAATGGCGTGAAGTTTACCAACAG TGAATTGTCCTCTTTAAATGAAGAATATA

CTAAGAACAAAGGCGAGTATGAAGAGGCCCAGGATGCCATTGTTAAAGAAATTGTCAATATTTCCTCAG GCTACGTAGAGCCAATGCAGACGCTCAACG

ATGTGCTGGCTCACTTAGACGCCATTGTTAGCTTCGCTCATGTGTCAAACGCAGCACCCGTTCCTTATGTACGACCAGTCATCTTGGAGAAAGGAAAAGG

GAGAATTATATTGAAAGCCTCCAGGCATGCTTGTGTTGAAGTTCAAGATGAAGTTGCATTTATTCCAAATGACGTGCACTTTGAAAAAGATAAACAGATG

TTCCACATCATTACTG GTCCCAATATGGGAGGTAAATCAACATACATTCGTCAGACCGGGGTGATTGTACTCATGGCCCAAATCGGGTGTTTTGTGCCC

TGTGAGTCGGCAGAAGTGTCCATTGTGGATTGCATCCTTGCTCGAGTCGGGGCTGGTGACAGTCAACTGAAAGGCGTCTCCACATTCATGGCTGAAATGC

TGGAGACTGCTTCCATCCTCAG GTCAGCAACCAAAGACTCCTTAATAATCATTGATGAGCTGGGAAGAGGAACCTCTACCTATGATGGATTTGGGTTAG

CATGGGCTATATCAGATTACATTGCAACGAAGATTGGTGCCTTTTGCATGTTTGCCACCCATTTTCATGAACTTACTGCTTTGGCCAACCAAATACCAAC

TGTTAATAATCTACATGTCACAGCGCTCACTACTGAGGAGACCCTAACTATGCTTTACCAAGTGAAAAAAG GTGTCTGTGATCAGAGTTTCGGGATTCA

CGTGGCTGAGCTCGCTAACTTCCCGAGGCACGTGATAGCGTGCGCCAAGCAGAAGGCTCTAGAGCTTGAAGAATTTCAGAACATTGGAACCTCGCTGGGA

TGTGACGAAGCCGAGCCGGCTGCAAAGAGACGCTGCCTGGAAAGAGAG - UNI7558 - CAAGGTGAGAAAATTATTCTGGAGTTCCTGTCGAAGGTC

AAGCAGGTGCCCTTTACTGCCATGTCGGAGGAGAGCATCTCCGCGAAGCTGAAGCAACTGAAAGCCGAGGTGGTCGCAAAGAACAACAGCTTCGTAAACG

AGATCATTTCACGGATAAAGGCTCCGGCTCCGTGAGGGGACAGTGGGTGGGCGTGCACGGGGGAGCTCACCTTTACTGTGTGCTGTTCTGGGTAGTGCTC

CCCACTGGAACCTGGCCTAGCAGCATCCGGAAGTGTTTAGTGATGCTTGAAAACATTACCGTCTGTAGCTGGGTGCTGTTTAAATGGGGACGGGCAACTG

TGAGCACTATGCTGAATTTTATAAATAAAATCATGTAGTTTGT
Translation
MAVQPKETLQLEGAAEAGFVRFFEGMPEKPSTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAG - UNI13895 - GSKTLQSVVLSKMNF

ESFVKDLLLVRQYRVEVYKNKAGNKASKENEWYLAFK - UNI13143 - ASPGNLSQFEDILFGNNDMSASVGVMGIKMAVVDGQRHVGVGYVDSTQR

KLGLCEFPENDQFSNLEALLIQIGPKECVLPGGETTGDMGKLRQ VIQRGGILITERKRADFSTKDIYQDLNRLLKGKKGEQINSAALPEMENQ VAVSS

LSAVIKFLELLSDDSNFGQFELATFDFSQYMKLDMAAVRALNLFQ - UNI12738 - GSVEDTTGSQSLAALLNKCKTAQGQRLVNQWIKQPLMDRNR

IEER - UNI12030 - RLNLVEAFVEDSELRQSLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPSVIQALEKYEG - UNI5181 - G

RHQALLLAVFVTPLIDLRSDFSKFQEMIETTLDMDQ - UNI4005 - VENHEFLVKPSFDPNLSELREVMDGLEKKMQSTLINAARGLG GLDPGKQI

KLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNS SELSSLNEEYTKNKGEYEEAQDAIVKEIVNISSG GYVEPMQTLNDVLAHLDAIVS

FAHVSNAAPVPYVRPVILEKGKGRIILKASRHACVEVQDEVAFIPNDVHFEKDKQMFHIITG GPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIV

DCILARVGAGDSQLKGVSTFMAEMLETASILR RSATKDSLIIIDELGRGTSTYDGFGLAWAISDYIATKIGAFCMFATHFHELTALANQIPTVNNLHVT

ALTTEETLTMLYQVKKG GVCDQSFGIHVAELANFPRHVIACAKQKALELEEFQNIGTSLGCDEAEPAAKRRCLERE - UNI7558 - QGEKIILEFL

SKVKQVPFTAMSEESISAKLKQLKAEVVAKNNSFVNEIISRIKAPAP

For any suggestions or comments, please send an email to unitrap@crg.es