Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024182 (Axin1)
Chromosomal location
Chr 17: 26275679 - 26332756 (+)
Description
axin 1 Gene [Source:MGI (curated);Acc:Axin1-001]
RefSeq_dna
NM_009733 
RefSeq_peptide
NP_033863.1 
UniGene
Mm.23684 
MGI
MGI:1096327 
Uniprot/SWISSPROT
O35625 
Uniprot/SPTREMBL
Q14DJ8 Q7TMI9 Q6IS36 
Human Ortholog
ENSG00000103126 (AXIN1)
Omim 114550 - HEPATOCELLULAR CARCINOMA  607864 - CAUDAL DUPLICATION ANOMALY  
UniTrap UNI29804
Vector Insertion
Chr 17: 26275987 - 26279562
Public Clones (sanger) E063D02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7584
Vector Insertion
Chr 17: 26319532 - 26321121
Public Clones RRR386 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1059
Vector Insertion
Chr 17: 26321260 - 26324648
Public Clones AY0151 (sanger) RRF390 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20542
Vector Insertion
Chr 17: 26329569 - 26330883
Public Clones not available
Private Clones OST359314 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118904
Sequence
GAGAGATTGATTCCCTTGGGAGCTGTAAGTACTGAGGTATTAGGGTGCAGCGCTCATTGTTCACTGATGCAGAGTCCCAAAATGAATGTCCAGGAGCAGG

GTTTCCCCTTGGACCTCGGAGCAAGTTTCACCGAAGATGCCCCCCGGCCCCCAGTGCCTGGAGAAGAGGGAGAACTGGTATCTACTGATTCGAGGCCTGT

CAACCACAGTTTCTGTTCTGGGAAAGGTACCAGCATTAAAAGTGAGACCTCAACAGCCACCCCAAGACGTTCAGATCTGGATCTGGGATATGAGCCCGAG

GGCAGTGCCTCCCCCACCCCACCATATTTGAGGTGGGCTGAGTCACTGCATTCCTTACTGGATGACCAAGATGGGATCAGCCTGTTCAGGACTTTCCTGA

AGCAGGAGGGCTGTGCTGACCTGCTGGACTTCTGGTTTGCCTGCAGTGGCTTCAGGAAGCTTGAGCCCTGTGACTCAAATGAGGAAAAGAGGCTGAAGCT

GGCAAGAGCCATCTACCGAAAGTACATCCTGGATAGCAATGGCATTGTGTCCAGACAAACCAAGCCAGCCACTAAGAGCTTCATAAAGGACTGTGTCATG

AAGCAGCAGATAGATCCTGCCATGTTTGACCAGGCACAGACAGAAATCCAGTCCACCATGGAGGAGAATACCTACCCTTCCTTTCTTAAGTCTGACATTT

ATTTGGAGTACACAAGGACAGGCTCAGAGAGTCCGAAGGTCTGCAGTGACCAGAGCTCAGGGTCTGGAACAGGGAAGGGCATGTCTGGATACCTGCCCAC

TTTGAATGAGGATGAAGAATGGAAATGTGACCAAGATGCAGATGAGGATGATGGCCGAGACCCTCTCCCCCCCAGCAGGCTCACCCAGAAGCTGCTATTG

GAGACTGCTGCCCCGAGGGCCCCCTCAAGTAGACGGTACAACGAAGGCAGAGAGCTCAG GTATGGATCTTGGAGGGAGCCCGTCAACCCCTACTACGTC

AACTCTGGCTATGCCCTGGCCCCAGCCACCAGTGCCAATGACAGTGAGCAGCAGAGCCTGTCCAGTGATGCTGACACGCTATCCCTTACGGACAGTAGTG

T GGATGGAATCCCCCCATACAGGATCCGTAAGCAGCACCGAAGGGAGATGCAGGAGAGTATCCAAGTCAATGGGCGGGTACCTCTACCTCACATTCCT 

- UNI7584 - CGCACTTACCGAATGCCAAAGGAGATCCGGGTAGAGCCACAGAAATTTGCTGAAGAGCTTATTCACCGTCTAGAGGCTGTCCAGCGCA

CTCGAGAGGCTGAAGAAAAGTTGGAGGAACGGCTGAAGCGTGTACGCATG - UNI1059 - GAGGAAGAAGGGGAGGATGGTGAAATGCCTTCTGGCC

CCATGGCAAGTCACAAGCTGCCTTCTGTCCCAGCTTGGCACCATTTCCCACCCCGCTATGTGGATATGGGCTGCTCTGGACTGCGGGATGCCCATGAGGA

GAATCCTGAGAGCATCCTGGATGAGCACGTGCAAAGGGTCATGAGGACACCTGGCTGCCAGTCACCTGGCCCAGGCCACCGCTCTCCTGACAGTGGGCAT

GTGGCTAAGACTGCAGTGCTAGGGGGTACAGCCTCCGGGCATGGGAAGCATGTTCCTAAGTTAGGGTTGAAGCTGGATACAGCTGGCCTGCACCATCATA

GACATGTCCACCACCATGTTCACCATAATTCAGCTAGACCTAAGGAGCAAATGGAGGCTGAAGTTGCCCGCAGGGTCCAGAGCAGCTTCTCGTGGGGCCC

AGAAACACATGGTCATGCCAAGCCCCGGAGCTATTCCGAGAACGCAGGCACCACCCTCAGTGCTGGGGATTTGGCCTTTGG TGGTAAAACTAGTGCACC

TTCCAAAAGAAACACCAAGAAGGCTGAATCTGGGAAGAATGCCAATGCTGAGGTACCCAGTACCACAGAGGACGCTGAGAAGAACCAGAAGATCATGCAG

TGGATCATTGAGGGAGAGAAGGAGATCAGTAGACACCGGAAGGCAGGCCATGG GTCTTCTGGGTTGAGGAAGCAGCAGGCCCATGAAAGCTCCAGGCCC

TTGTCCATCGAGCGTCCTGGGGCCGTGCACCCCTGGGTCAGCGCTCAGCTTCGGAATTCTGTCCAGCCTTCTCATCTTTTCATCCAAGATCCCACAATGC

CACCCAATCCAGCCCCTAATCCCCTGACCCAGCTGGAAGAGGCCCGCAGGCGTTTGGAAGAAGAAGAAAAGAGAGCAAACAAACTGCCCTCCAAGCAGAG

 - UNI20542 - GACAAAATCACAAAGAAAGGCAGGTGGCGGGAGTGCACCACCATGTGACAGCATTGTTGTGGCCTACTATTTCTGTGGGGAACCCA

TCCCCTACCGGACCCTGGTGAGGGGCCGTGCTGTCACCCTGGGCCAGTTCAAGGAGCTGCTAACCAAGAAGGGGAGCTACAG ATACTACTTTAAGAAAG

TGAGTGATGAGTTTGACTGTGGTGTGGTATTTGAGGAAGTACGGGAGGATGAGGCCGTCTTGCCTGTCTTTGAAGAAAAGATCATCGGCAAGGTGGAAAA

GGTGGACTGAGCACTGGGCAGCACACCCGGAGCACACCATCACTACTGTGCACTGTCATCAGTCAGGTGGACAGCCTTGTCCTCAGGAGCCTGGTGTGGG

GAACAACACAAGATTGTGTCATGAGCTCTTCTATCGGGGTGAGGCTGGGGACCTTAGGTGTCTGCCAGCCTCTGTCCCTCTGGCTTTGGG
Translation
MNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSETSTATPRRSDLDLGYEPEGSASPTPPYLRWAESLHSLLDDQDGIS

LFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPS

FLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPTLNEDEEWKCDQDADEDDGRDPLPPSRLTQKLLLETAAPRAPSSRRYNEGRELR RYGSWR

EPVNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSV VDGIPPYRIRKQHRREMQESIQVNGRVPLPHIP - UNI7584 - RTYRMPKEIRV

EPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRM - UNI1059 - EEEGEDGEMPSGPMASHKLPSVPAWHHFPPRYVDMGCSGLRDAHEENPESIL

DEHVQRVMRTPGCQSPGPGHRSPDSGHVAKTAVLGGTASGHGKHVPKLGLKLDTAGLHHHRHVHHHVHHNSARPKEQMEAEVARRVQSSFSWGPETHGHA

KPRSYSENAGTTLSAGDLAFG GGKTSAPSKRNTKKAESGKNANAEVPSTTEDAEKNQKIMQWIIEGEKEISRHRKAGHG GSSGLRKQQAHESSRPLSI

ERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEEEEKRANKLPSKQR - UNI20542 - RTKSQRKAGGGSAPPCDSIVVA

YYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYR RYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD
Transcript ENSMUST00000115005
Sequence
CTCTGGGCTCAGGCTCCCGGCTCAGGGAAGCGCTTGCGGCCGCCGCCGCAGGAGCCTGCTGGGGTCGGGCTGGAGCCTGGTTCCAGAGAGGGCTGGTGAG

AGTGAGCAGCCGGTTTTGGCGGCGCTCTGCGGCCTGCCTTGCGCCGCCTCCGGGCCACGGGTCGCCGAGCCGCCGCCGCCGCCGCGATGGGGGCCCCCCA

GGGCCGCGCCCCCGCCGTGGCCCGCCCGCTGAGCCGCCGCTGAGCGCATGGGCCTCGCCGGGCCGGGAGCCAGGCCCCGGGCCGCGCCTCCACAGCCGCC

GCGCGCTG - UNI29804 - GAGAGATTGATTCCCTTGGGAGCTGTAAGTACTGAGGTATTAGGGTGCAGCGCTCATTGTTCACTGATGCAGAGTCCC

AAAATGAATGTCCAGGAGCAGGGTTTCCCCTTGGACCTCGGAGCAAGTTTCACCGAAGATGCCCCCCGGCCCCCAGTGCCTGGAGAAGAGGGAGAACTGG

TATCTACTGATTCGAGGCCTGTCAACCACAGTTTCTGTTCTGGGAAAGGTACCAGCATTAAAAGTGAGACCTCAACAGCCACCCCAAGACGTTCAGATCT

GGATCTGGGATATGAGCCCGAGGGCAGTGCCTCCCCCACCCCACCATATTTGAGGTGGGCTGAGTCACTGCATTCCTTACTGGATGACCAAGATGGGATC

AGCCTGTTCAGGACTTTCCTGAAGCAGGAGGGCTGTGCTGACCTGCTGGACTTCTGGTTTGCCTGCAGTGGCTTCAGGAAGCTTGAGCCCTGTGACTCAA

ATGAGGAAAAGAGGCTGAAGCTGGCAAGAGCCATCTACCGAAAGTACATCCTGGATAGCAATGGCATTGTGTCCAGACAAACCAAGCCAGCCACTAAGAG

CTTCATAAAGGACTGTGTCATGAAGCAGCAGATAGATCCTGCCATGTTTGACCAGGCACAGACAGAAATCCAGTCCACCATGGAGGAGAATACCTACCCT

TCCTTTCTTAAGTCTGACATTTATTTGGAGTACACAAGGACAGGCTCAGAGAGTCCGAAGGTCTGCAGTGACCAGAGCTCAGGGTCTGGAACAGGGAAGG

GCATGTCTGGATACCTGCCCACTTTGAATGAGGATGAAGAATGGAAATGTGACCAAGATGCAGATGAGGATGATGGCCGAGACCCTCTCCCCCCCAGCAG

GCTCACCCAGAAGCTGCTATTGGAGACTGCTGCCCCGAGGGCCCCCTCAAGTAGACGGTACAACGAAGGCAGAGAGCTCAG GTATGGATCTTGGAGGGA

GCCCGTCAACCCCTACTACGTCAACTCTGGCTATGCCCTGGCCCCAGCCACCAGTGCCAATGACAGTGAGCAGCAGAGCCTGTCCAGTGATGCTGACACG

CTATCCCTTACGGACAGTAGTGT GGATGGAATCCCCCCATACAGGATCCGTAAGCAGCACCGAAGGGAGATGCAGGAGAGTATCCAAGTCAATGGGCGG

GTACCTCTACCTCACATTCCT - UNI7584 - CGCACTTACCGAATGCCAAAGGAGATCCGGGTAGAGCCACAGAAATTTGCTGAAGAGCTTATTCAC

CGTCTAGAGGCTGTCCAGCGCACTCGAGAGGCTGAAGAAAAGTTGGAGGAACGGCTGAAGCGTGTACGCATG - UNI1059 - GAGGAAGAAGGGGAG

GATGGTGAAATGCCTTCTGGCCCCATGGCAAGTCACAAGCTGCCTTCTGTCCCAGCTTGGCACCATTTCCCACCCCGCTATGTGGATATGGGCTGCTCTG

GACTGCGGGATGCCCATGAGGAGAATCCTGAGAGCATCCTGGATGAGCACGTGCAAAGGGTCATGAGGACACCTGGCTGCCAGTCACCTGGCCCAGGCCA

CCGCTCTCCTGACAGTGGGCATGTGGCTAAGACTGCAGTGCTAGGGGGTACAGCCTCCGGGCATGGGAAGCATGTTCCTAAGTTAGGGTTGAAGCTGGAT

ACAGCTGGCCTGCACCATCATAGACATGTCCACCACCATGTTCACCATAATTCAGCTAGACCTAAGGAGCAAATGGAGGCTGAAGTTGCCCGCAGGGTCC

AGAGCAGCTTCTCGTGGGGCCCAGAAACACATGGTCATGCCAAGCCCCGGAGCTATTCCGAGAACGCAGGCACCACCCTCAGTGCTGGGGATTTGGCCTT

TGG TGGTAAAACTAGTGCACCTTCCAAAAGAAACACCAAGAAGGCTGAATCTGGGAAGAATGCCAATGCTGAGGTACCCAGTACCACAGAGGACGCTGA

GAAGAACCAGAAGATCATGCAGTGGATCATTGAGGGAGAGAAGGAGATCAGTAGACACCGGAAGGCAGGCCATGG GTCTTCTGGGTTGAGGAAGCAGCA

GGCCCATGAAAGCTCCAGGCCCTTGTCCATCGAGCGTCCTGGGGCCGTGCACCCCTGGGTCAGCGCTCAGCTTCGGAATTCTGTCCAGCCTTCTCATCTT

TTCATCCAAGATCCCACAATGCCACCCAATCCAGCCCCTAATCCCCTGACCCAGCTGGAAGAGGCCCGCAGGCGTTTGGAAGAAGAAGAAAAGAGAGCAA

ACAAACTGCCCTCCAAGCAGAG - UNI20542 - GACAAAATCACAAAGAAAGGCAGGTGGCGGGAGTGCACCACCATGTGACAGCATTGTTGTGGCC

TACTATTTCTGTGGGGAACCCATCCCCTACCGGACCCTGGTGAGGGGCCGTGCTGTCACCCTGGGCCAGTTCAAGGAGCTGCTAACCAAGAAGGGGAGCT

ACAG ATACTACTTTAAGAAAGTGAGTGATGAGTTTGACTGTGGTGTGGTATTTGAGGAAGTACGGGAGGATGAGGCCGTCTTGCCTGTCTTTGAAGAAA

AGATCATCGGCAAGGTGGAAAAGGTGGACTGAGCACTGGGCAGCACACCCGGAGCACACCATCACTACTGTGCACTGTCATCAGTCAGGTGGACAGCCTT

GTCCTCAGGAGCCTGGTGTGGGGAACAACACAAGATTGTGTCATGAGCTCTTCTATCGGGGTGAGGCTGGGGACCTTAGGTGTCTGCCAGCCTCTGTCCC

TCTGGCTTTGGGAAAGTGGGGGTGGGGGGTCGTCCTACTGAGTGGTTCCTTGGGTTTCTCTGTTTTGCTGTTCAAGAGGAAAGTTCCACTTACCACCACA

TTACCCCCTGAAGCAATACCAGGAGCCATCTCATGACCCTCAGCAGCTCTTGCTTCTGAATCCAGTCTGACCTAGGGATACTTTGCCCTGGGCTTGTATC

CCACTGTCCTCTTCTCTCTCTCTGGGACCTATCCACTGCACCTGGTTGGGCTCAGGTCCAGGAGCAGGGGATCCTGTGGGGGCCTCTATATATTGTACAT

GTCACTGAGTGCCTTCAACATAGCTGTCTCTTGCCTGCCACTGTGTGAATCTGGCAGCTGAGTATCTCAGGCCCCTTTGCCTGTCTCTAGCCACCAGCTT

GGTTCAGCAGGAGGGGGGGCGGTGTGTCTGGTCCCTTCCAAGTGTCCGTGTAAATATGTACATTTCTCAGGCCAGGGCCAGCAGGGGGATACCCTGAGCC

CATTTTTCATGCAATGACTTGTACAATTATCTTTTCAAAGGTACTTGGATAATAATGAAATAAAAACGTTTTTGAACCTTCC
Translation
 - UNI29804 - MNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSETSTATPRRSDLDLGYEPEGSASPTPPYLRWA

ESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPAMFDQAQ

TEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPTLNEDEEWKCDQDADEDDGRDPLPPSRLTQKLLLETAAPRAPSSRRY

NEGRELR RYGSWREPVNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSV VDGIPPYRIRKQHRREMQESIQVNGRVPLPHIP - UNI7584

 - RTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRM - UNI1059 - EEEGEDGEMPSGPMASHKLPSVPAWHHFPPRYVDMGCS

GLRDAHEENPESILDEHVQRVMRTPGCQSPGPGHRSPDSGHVAKTAVLGGTASGHGKHVPKLGLKLDTAGLHHHRHVHHHVHHNSARPKEQMEAEVARRV

QSSFSWGPETHGHAKPRSYSENAGTTLSAGDLAFG GGKTSAPSKRNTKKAESGKNANAEVPSTTEDAEKNQKIMQWIIEGEKEISRHRKAGHG GSSGL

RKQQAHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEEEEKRANKLPSKQR - UNI20542 - RTKSQRKA

GGGSAPPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYR RYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD
Transcript ENSMUST00000074370
Sequence
CTCTGGGCTCAGGCTCCCGGCTCAGGGAAGCGCTTGCGGCCGCCGCCGCAGGAGCCTGCTGGGGTCGGGCTGGAGCCTGGTTCCAGAGAGGGCTGGTGAG

AGTGAGCAGCCGGTTTTGGCGGCGCTCTGCGGCCTGCCTTGCGCCGCCTCCGGGCCACGGGTCGCCGAGCCGCCGCCGCCGCCGCGATGGGGGCCCCCCA

GGGCCGCGCCCCCGCCGTGGCCCGCCCGCTGAGCCGCCGCTGAGCGCATGGGCCTCGCCGGGCCGGGAGCCAGGCCCCGGGCCGCGCCTCCACAGCCGCC

GCGCGCTG - UNI29804 - GAGAGATTGATTCCCTTGGGAGCTGTAAGTACTGAGGTATTAGGGTGCAGCGCTCATTGTTCACTGATGCAGAGTCCC

AAAATGAATGTCCAGGAGCAGGGTTTCCCCTTGGACCTCGGAGCAAGTTTCACCGAAGATGCCCCCCGGCCCCCAGTGCCTGGAGAAGAGGGAGAACTGG

TATCTACTGATTCGAGGCCTGTCAACCACAGTTTCTGTTCTGGGAAAGGTACCAGCATTAAAAGTGAGACCTCAACAGCCACCCCAAGACGTTCAGATCT

GGATCTGGGATATGAGCCCGAGGGCAGTGCCTCCCCCACCCCACCATATTTGAGGTGGGCTGAGTCACTGCATTCCTTACTGGATGACCAAGATGGGATC

AGCCTGTTCAGGACTTTCCTGAAGCAGGAGGGCTGTGCTGACCTGCTGGACTTCTGGTTTGCCTGCAGTGGCTTCAGGAAGCTTGAGCCCTGTGACTCAA

ATGAGGAAAAGAGGCTGAAGCTGGCAAGAGCCATCTACCGAAAGTACATCCTGGATAGCAATGGCATTGTGTCCAGACAAACCAAGCCAGCCACTAAGAG

CTTCATAAAGGACTGTGTCATGAAGCAGCAGATAGATCCTGCCATGTTTGACCAGGCACAGACAGAAATCCAGTCCACCATGGAGGAGAATACCTACCCT

TCCTTTCTTAAGTCTGACATTTATTTGGAGTACACAAGGACAGGCTCAGAGAGTCCGAAGGTCTGCAGTGACCAGAGCTCAGGGTCTGGAACAGGGAAGG

GCATGTCTGGATACCTGCCCACTTTGAATGAGGATGAAGAATGGAAATGTGACCAAGATGCAGATGAGGATGATGGCCGAGACCCTCTCCCCCCCAGCAG

GCTCACCCAGAAGCTGCTATTGGAGACTGCTGCCCCGAGGGCCCCCTCAAGTAGACGGTACAACGAAGGCAGAGAGCTCAG GTATGGATCTTGGAGGGA

GCCCGTCAACCCCTACTACGTCAACTCTGGCTATGCCCTGGCCCCAGCCACCAGTGCCAATGACAGTGAGCAGCAGAGCCTGTCCAGTGATGCTGACACG

CTATCCCTTACGGACAGTAGTGT GGATGGAATCCCCCCATACAGGATCCGTAAGCAGCACCGAAGGGAGATGCAGGAGAGTATCCAAGTCAATGGGCGG

GTACCTCTACCTCACATTCCT - UNI7584 - CGCACTTACCGAATGCCAAAGGAGATCCGGGTAGAGCCACAGAAATTTGCTGAAGAGCTTATTCAC

CGTCTAGAGGCTGTCCAGCGCACTCGAGAGGCTGAAGAAAAGTTGGAGGAACGGCTGAAGCGTGTACGCATG - UNI1059 - GAGGAAGAAGGGGAG

GATGGTGAAATGCCTTCTGGCCCCATGGCAAGTCACAAGCTGCCTTCTGTCCCAGCTTGGCACCATTTCCCACCCCGCTATGTGGATATGGGCTGCTCTG

GACTGCGGGATGCCCATGAGGAGAATCCTGAGAGCATCCTGGATGAGCACGTGCAAAGGGTCATGAGGACACCTGGCTGCCAGTCACCTGGCCCAGGCCA

CCGCTCTCCTGACAGTGGGCATGTGGCTAAGACTGCAGTGCTAGGGGGTACAGCCTCCGGGCATGGGAAGCATGTTCCTAAGTTAGGGTTGAAGCTGGAT

ACAGCTGGCCTGCACCATCATAGACATGTCCACCACCATGTTCACCATAATTCAGCTAGACCTAAGGAGCAAATGGAGGCTGAAGTTGCCCGCAGGGTCC

AGAGCAGCTTCTCGTGGGGCCCAGAAACACATGGTCATGCCAAGCCCCGGAGCTATTCCGAGAACGCAGGCACCACCCTCAGTGCTGGGGATTTGGCCTT

TGG TGGTAAAACTAGTGCACCTTCCAAAAGAAACACCAAGAAGGCTGAATCTGGGAAGAATGCCAATGCTGAGGTACCCAGTACCACAGAGGACGCTGA

GAAGAACCAGAAGATCATGCAGTGGATCATTGAGGGAGAGAAGGAGATCAGTAGACACCGGAAGGCAGGCCATGG GTCTTCTGGGTTGAGGAAGCAGCA

GGCCCATGAAAGCTCCAGGCCCTTGTCCATCGAGCGTCCTGGGGCCGTGCACCCCTGGGTCAGCGCTCAGCTTCGGAATTCTGTCCAGCCTTCTCATCTT

TTCATCCAAGATCCCACAATGCCACCCAATCCAGCCCCTAATCCCCTGACCCAGCTGGAAGAGGCCCGCAGGCGTTTGGAAGAAGAAGAAAAGAGAGCAA

ACAAACTGCCCTCCAAGCAGAG GTATGTGCAGGCAGTCATGCAGCGGGGACGCACCTGTGTCAGGCCAGCTTGTGCACCGGTGCTGAGTGTGGTACCAG

CCGTGTCGGACTTGGAACTCTCCGAGACAGA - UNI20542 - GACAAAATCACAAAGAAAGGCAGGTGGCGGGAGTGCACCACCATGTGACAGCATT

GTTGTGGCCTACTATTTCTGTGGGGAACCCATCCCCTACCGGACCCTGGTGAGGGGCCGTGCTGTCACCCTGGGCCAGTTCAAGGAGCTGCTAACCAAGA

AGGGGAGCTACAG ATACTACTTTAAGAAAGTGAGTGATGAGTTTGACTGTGGTGTGGTATTTGAGGAAGTACGGGAGGATGAGGCCGTCTTGCCTGTCT

TTGAAGAAAAGATCATCGGCAAGGTGGAAAAGGTGGACTGAGCACTGGGCAGCACACCCGGAGCACACCATCACTACTGTGCACTGTCATCAGTCAGGTG

GACAGCCTTGTCCTCAGGAGCCTGGTGTGGGGAACAACACAAGATTGTGTCATGAGCTCTTCTATCGGGGTGAGGCTGGGGACCTTAGGTGTCTGCCAGC

CTCTGTCCCTCTGGCTTTGGGAAAGTGGGGGTGGGGGGTCGTCCTACTGAGTGGTTCCTTGGGTTTCTCTGTTTTGCTGTTCAAGAGGAAAGTTCCACTT

ACCACCACATTACCCCCTGAAGCAATACCAGGAGCCATCTCATGACCCTCAGCAGCTCTTGCTTCTGAATCCAGTCTGACCTAGGGATACTTTGCCCTGG

GCTTGTATCCCACTGTCCTCTTCTCTCTCTCTGGGACCTATCCACTGCACCTGGTTGGGCTCAGGTCCAGGAGCAGGGGATCCTGTGGGGGCCTCTATAT

ATTGTACATGTCACTGAGTGCCTTCAACATAGCTGTCTCTTGCCTGCCACTGTGTGAATCTGGCAGCTGAGTATCTCAGGCCCCTTTGCCTGTCTCTAGC

CACCAGCTTGGTTCAGCAGGAGGGGGGGCGGTGTGTCTGGTCCCTTCCAAGTGTCCGTGTAAATATGTACATTTCTCAGGCCAGGGCCAGCAGGGGGATA

CCCTGAGCCCATTTTTCATGCAATGACTTGTACAATTATCTTTTCAAAGGTACTTGGATAATAATGAAATAAAAACGTTTTTGAACCTTCC
Translation
 - UNI29804 - MNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSETSTATPRRSDLDLGYEPEGSASPTPPYLRWA

ESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPAMFDQAQ

TEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPTLNEDEEWKCDQDADEDDGRDPLPPSRLTQKLLLETAAPRAPSSRRY

NEGRELR RYGSWREPVNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSV VDGIPPYRIRKQHRREMQESIQVNGRVPLPHIP - UNI7584

 - RTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRM - UNI1059 - EEEGEDGEMPSGPMASHKLPSVPAWHHFPPRYVDMGCS

GLRDAHEENPESILDEHVQRVMRTPGCQSPGPGHRSPDSGHVAKTAVLGGTASGHGKHVPKLGLKLDTAGLHHHRHVHHHVHHNSARPKEQMEAEVARRV

QSSFSWGPETHGHAKPRSYSENAGTTLSAGDLAFG GGKTSAPSKRNTKKAESGKNANAEVPSTTEDAEKNQKIMQWIIEGEKEISRHRKAGHG GSSGL

RKQQAHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEEEEKRANKLPSKQR RYVQAVMQRGRTCVRPACAPV

LSVVPAVSDLELSETE - UNI20542 - ETKSQRKAGGGSAPPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYR RYYFKKVSDEFD

CGVVFEEVREDEAVLPVFEEKIIGKVEKVD

For any suggestions or comments, please send an email to unitrap@crg.es