Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024212 (Mllt1)
Chromosomal location
Chr 17: 57032035 - 57074836 (-)
Description
myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 1 Gene [Source:MGI Symbol;Acc:MGI:1927238]
RefSeq_dna
NM_022328 
RefSeq_peptide
NP_071723.1 
UniGene
Mm.148748 Mm.412364 
MGI
MGI:1927238 
Uniprot/SPTREMBL
A4VCJ2 Q8CJ76 Q9EPX7 Q9ERL0 
Human Ortholog
ENSG00000130382 (MLLT1)
Omim not available
UniTrap UNI14537
Vector Insertion
Chr 17: 57066414 - 57074837
Public Clones FHCRC-GT-S7-1D1 (fhcrc)
Private Clones OST219284 (lexicon) OST212518 (lexicon) OST56828 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30076
Vector Insertion
Chr 17: 57045134 - 57059406
Public Clones D124G10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025053
Sequence
GCGCGGCTGGCGGGCGGGCGGGCGGCCCGGAACGGCGGCGGCGGCGGTGCGGCCCCCGACAGACAATGAGAGCGGCGGGGCGTTGCTGAGCGGCGGCAGC

GAGAGCGACGCGGGCCCGGGGGCGGGGCGGGCGCCAGTCATGGACAATCAG - UNI14537 - TGCACTGTCCAGGTGAAGTTAGAGCTGGGGCACCG

TGCCCAGCTACGGAAGAAGCCCACCACCGAGGGCTTCACCCATGACTGGATGGTCTTCGTGCGTGGCCCTGAGCAGTGTGACATCCAGCACTTTGTGGAG

AAGGTCATCTTCCGGCTGCATGACAGCTTCCCTAAACCCAAGCGTG - UNI14537 - - UNI30076 - TGTGCAAGGAGCCCCCCTACAAAGTGG

AGGAGTCGGGCTATGCAGGCTTCATCATGCTCATTGAAGTGTACTTCAAAAACAAG - UNI30076 - GAGGAGCCGAGGAAGGTCTGCTTCACCTAC

GACCTGTTTCTCAACCTGGAGGGCAACCCTCCTGTCAACCACCTGCGCTGTGAGAAGCTCACCTTCAATAACCCCACCACCGAGTTTCGCTGCAAGCTGC

TCATGGCTGGAGGG - UNI30076 - GTGATGGTAATGCCCGAAGGAGCGGACACGGTGTCCAGGCCCAGCCCTGACTACCCCATGTTACCCACAATT

CCACTCTCTGCCTTCTCTGACCCCAAGAAGAACAAACCATCCCACGGCTCCAAG GATGCCAACAAGGAGAGTGGCAAGGCTTCCAAACCACACAAGGTG

GCCAGGGAGCACCGTGAGCGGCCGCGCAAGGACTCAGAGAGCAGGAGTTGCTCCAAGGAGCCGGAGCGTGAGCCCAAGAGTGCCAAGGATGCTGCACGCA

AGCTGCCCAAGGAGGAGAAGGCCCCAGTGCCCAAGGCTGCCTTCAAGGAGCCCAAGATGGCCCTAAAGGAAACCAAGCTGGAGAGCCTGTCCCCCAAGGG

GGTGCCCCAGCCTCCTACCCTGCCCAAGGCCTCCAGCAAGAGGCCAGCTGCCACGGACTCACCGAAGCTCAGCGCCAAAAAGCCTAAAAAGAGTGGGTCA

AAGGGGACACGGCGTGCACCAGGCACCTCACCCCGAGCTTCCTCCTTTCCTGACAAGAAGGTGGCCAGGGACAAGAACAGCAAAGGTGACAAGGGGAAGG

CAGAGAGTGAGCCTCGGGAGGCCAAGCGGACTCTGCAGACTGAAGACTCAAACTCAGAGGATGAGGCCTCCTTCCGGTCAGAG TCGGCCCAGTCAAGCC

CAGCTAATGCCAGCTCCAGCTCTGACTCCAGCTCTGACTCAGACTTTGAGCCGTCTCAGAACCACAGCCAAG GACCCCTGCGCTCCATGGTGGAGGACC

TGCAGTCTGAGGGCTCTGATGAGGATGACTCATCGTCAGGAGAGGAGAACACCGGCAAGGCCAACCCAGGCCGGGAGTCCAG GCTAAGCTTCAGTGACA

GCGAGAGTGACAACAGCGCAGACTCCTGCCTGCCTGGCCGTGAGCCCCTGCCTCCCCAGAAGCCGCCCCCTCCCAGCAGCAAG GTGTCTGGTCGGAGGA

GCCCCGAGCCCTGCAGCAAGCCCGAAAAGATGCTGAAGAAGGCTACCTATGACAAG GCTTACACGGATGAGCTGGTGGAGCTGCACCGGAGACTGATGG

CTCTGCGCGAGCGCAATGTGCTGCAGCAG ATTGTCAATCTGATCGAGGAGACTGGCCACTTCAATGTCACCAACACCACCTTCGACTTTGACCTTTTCT

CCTTGGATGAAAGCACTGTTCGCAAGCTGCAGAGCTGCCTGGAGGCCGTGGCCACATGACCCCGGCTGCCACTGTGGAGCCACGGTGGGCATGGTGGGCA

CGGGAGGGGCTGGGCATGAGGGCTGGCCCGCCATGGCTTCCGCTCCCGGTACCACCCCCAACTAACCATGGTGCCCCAGTACCCCTCAGTGGTTGGTGAT

GAAGGGGTGCTGCAGGCCACACACAGGGTGGGGTGACATAGGACACACGTGGCCTGCAGCCCCTCACTTAGTCCCTGCCAGTTGTCCATTGTGGGTGGGA

CTGAATGGCAGATTACTGCCTGGGCCTCTCTGGGTGGCCAGGATGACCACAGTCTTCCACACAGTTCACAGGCCTCTCTCAGCTGGCCTGCCTCCTAGAC

TTGAGGGTCCGTTAGCCTGGCCAGAGCCAGCTATGTGCACCTGCTTCTGCCATGCAGCCTTGTGCATGTGTGTGCTCCAGGTGCAGCCAGCAGCCGGGGG

GCTCAGGCCACCCCTCTGCTGGAGGCACAGAGGATCTCCCCTCTAGATCCTAGGATGCCACTGCCTCTCGAGGCCCCAGGCCAGAGAACACTACAATGGG

CACCAATCTTGGGACCCCAAGGGCCACCACTGCAGCCATGTGCCAGCTAAGCACCCACAGTTCCAAGGCTAGCTGGACTGGCAGCACTCCTGGGCCACCA

TTCCCCGTGGGCCTCCTCCTCTGCTCTCTCACTGATCAAGTCTTTGAACTTTGAAAACATGAGCTTTTGCCAAATATGATAGGATGGTGTGTGTGAGGCC

GGCCCAACCCTAGACTGCCTCTGTTCCTGGCCACATGTGCGCCTGGAGAGGCTTTGGACCTGTGCCCTGCAAACTGCCAGGGGTCAAGCCAGCCCCCTTC

CCCTGTCTGAGCCTGGAGTGCCACCCCTTCCCCAACTTCAGTTGTCGGTGTTTGTGCCCCAACCAAGGTGTTTGAAAGAGGCCTGAGCTGAAGCCAGCTC

ACAGTTGCCTCGATGTGTTGCTTCCTCCCCATTGTGGGTTCACCCCTGGAGGCCTGGCCTCCCAGCTCCCTCTCCCTGTCTGTCCCACTCCCAAACTATC

TGTCAGGAAGATCCTGAACACTCCTGGGGACCCCAGCCTCTAAGGCTTCCTTTACCCCCAGAGAAAGGAAAAGGCCTCTGCCTGTAGCCCCTGTTCACAC

TCCCTATAGCTGGGAGGAAACAGGGCTCGTGCCCCAACCTCTTTCCACACAGGCCGACAATACTCTCCATCAGGTGTTCTGCAGCCTCTAAGCCTTTTCA

TAGAAGGCCCTGGCATCGTGGCAGCTGTTGGCCTCCACATGGAGTGCGCCAGGGTCCCAAACAGCCTCAGCCCAGGGCACCATTCTTCCTCTCATGGTCG

CTAGCGGCCCAGCCCTTCTGCTGCCCTGGGCCTTGGTGTCTAGTCCTTCCAGATGCTTCCAGGGTCGTCCTGAAAACACCCACCCATCTCTTCAGTTACC

TCCTCTGGCCAGAAGGTCACACCACTGTCCTCCAGAGCCACTCTGGGGCCCATACTGGCTGTCTGGAAGCCTAAAGCAGCAGCCTGCAGCCAGAGCCGAG

GGTTCTAGGGACTTGTCCATAGGAAGGGGTGGCACTATGTATACCCTCAGTGAGTCCCTTTGCTGCAGCCTCCTGAACCAGTTCATGACACTGAGTGCAA

AAGGTATTGGATACCTATCCCTCCCCAGGGCTTCACAAGACATGTCTCCATGAATAGACACGTCACTGGCCCAGACGAGCCCTGGACAGAGGGACCAGGA

GAGCTGTGTTTGTAACAAGCTGCAGGGCCATTTGTCCCGCATTTTAAACTTTTTTGTTAAATTGTGAAATGATGGAGGAGTTTTATAGAAAATAAAGTGA

GATGGGAGC
Translation
MDNQ - UNI14537 - CTVQVKLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVIFRLHDSFPKPKRV - UNI14537 - - UNI30

076 - VCKEPPYKVEESGYAGFIMLIEVYFKNK - UNI30076 - EEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRCKLLMAGG - U

NI30076 - VMVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKNKPSHGSK DANKESGKASKPHKVAREHRERPRKDSESRSCSKEPEREPKSAKDAA

RKLPKEEKAPVPKAAFKEPKMALKETKLESLSPKGVPQPPTLPKASSKRPAATDSPKLSAKKPKKSGSKGTRRAPGTSPRASSFPDKKVARDKNSKGDKG

KAESEPREAKRTLQTEDSNSEDEASFRSE SAQSSPANASSSSDSSSDSDFEPSQNHSQG GPLRSMVEDLQSEGSDEDDSSSGEENTGKANPGRESR R

LSFSDSESDNSADSCLPGREPLPPQKPPPPSSK VSGRRSPEPCSKPEKMLKKATYDK AYTDELVELHRRLMALRERNVLQQ IVNLIEETGHFNVTNT

TFDFDLFSLDESTVRKLQSCLEAVAT

For any suggestions or comments, please send an email to unitrap@crg.es