Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024223 (4930511I11Rik)
Chromosomal location
Chr 17: 28667806 - 28676052 (+)
Description
RIKEN cDNA 4930511I11 gene Gene [Source:MGI Symbol;Acc:MGI:1914895]
Human Ortholog
not available
Omim not available
UniTrap UNI36793
Vector Insertion
Chr 17: 28674898 - 28675530
Public Clones IST14972F8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025060
Sequence
AGCCACAAGGCAGCACGGAAGACATGGGCAAGACCATTCCCCGGTTCCTGGAGCAACTGGACCTCATCAAAAGCTTCGTGGGCCTGGCTACAGGCGCCGG

GGCCTTATACCTGCTGTACAAGGCCGTCAGGACTGGCTTAAAATGTCATCCGCCACTCTGCTCCAACTCGCCGATCTGCATTGCCC GCCTGGCCATCGA

GAGAGAGCGCCACGGGCGGGACTCCGGTGAGATTCGAAGACTTCTCAACTCTCTAGACTGCAAACAGGATGAGTATACCAGGAGCATGATCCTTCATAAC

ATCACCCGCTGCGTGTACTTGCTGGAGGCTGAG GCCTCTTCTTGTACTATGGATGACATCGACTTGGTGGCTGACATGCTAGATGAGAAGGACAACAGT

GTAAAAATCCAAGCTCTGAATGCACTTAAAGCTTTCTCTGGCATCAGGAAATTCAGGCTCAAAATCCAG GAGCATTGCATCAAGGTACTGGAACTGATT

TCCACCATCTGGGACTTGGAATTGCACGTAGCTGGTCTCCGATTGCTCAACAACCTCCCGCTACCTGACTATGTGCACCCACAGCTGCGGCGGGTGATGC

CTGCCCTGATGGAGATCATACAGTCAGACTGCATCCTGGCACAG GTACAAGCTGTCCGCCTCCTGAGTTACCTGGCACAGAAGAACGACCTTCTTTATG

ACATTCTCAACTGTCAG - UNI36793 - GTGCGTCCCAACTTCCTGAACCTCTTCCAGTCTTCACAGCCGGGCAGTCTGCTGTTCGAGGTGCTGGTG

TTTGCGGAACACTTGAGTGAAGGTCGGAACGCCACCCACTACCGAGCGGTCAAATGGCATTACAACGAGCAATCCCTGCACGAAGCCCTCTTTGGGGATG

AGTCCAGACTGGCAGACCGACTGCTCTCCCTGGTCATCCACCCTGAGGAGGAAGTTCAGATCCAGGCCTGCAAAGTCATAGTGAGCTTGCAGTGTCCCCA

GGACCTGGGATCCCGACCCTCTTCCTGCCGACCTAGCCATTCCTGCTTTAAAACCGGGAAGTGAAGTTAAGGAGATCCAATAAATGCGTACGGGAGGGAA

GCTCGAGGCCTCCGGAAGCAAGCGTCTGTCCGTTGCCTCCCAGGACCTGGGTGGAGGTGCTGTTCATCAGGGCCTCCCCCTAGGCCGTGGAACAGCACCC

AAACACATCCCACTTCTGTGTTTGGGAGACTGCCCCTTCTGTTGCTGCTCTTC
Translation
MGKTIPRFLEQLDLIKSFVGLATGAGALYLLYKAVRTGLKCHPPLCSNSPICIAR RLAIERERHGRDSGEIRRLLNSLDCKQDEYTRSMILHNITRCVY

LLEAE ASSCTMDDIDLVADMLDEKDNSVKIQALNALKAFSGIRKFRLKIQ EHCIKVLELISTIWDLELHVAGLRLLNNLPLPDYVHPQLRRVMPALME

IIQSDCILAQ VQAVRLLSYLAQKNDLLYDILNCQ - UNI36793 - VRPNFLNLFQSSQPGSLLFEVLVFAEHLSEGRNATHYRAVKWHYNEQSLHE

ALFGDESRLADRLLSLVIHPEEEVQIQACKVIVSLQCPQDLGSRPSSCRPSHSCFKTGK

For any suggestions or comments, please send an email to unitrap@crg.es