Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024300 (Myo1f)
Chromosomal location
Chr 17: 33692664 - 33744703 (+)
Description
myosin IF Gene [Source:MGI Symbol;Acc:MGI:107711]
RefSeq_dna
NM_053214 
RefSeq_peptide
NP_444444.1 
UniGene
Mm.42019 
MGI
MGI:107711 
Uniprot/SWISSPROT
P70248 
Uniprot/SPTREMBL
Q6KAL9 Q811E7 Q8CG29 Q91ZI3 Q9CRE1 
Human Ortholog
ENSG00000142347 (MYO1F)
Omim not available
UniTrap UNI36651
Vector Insertion
Chr 17: 33692802 - 33712735
Public Clones IST10107F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34483
Vector Insertion
Chr 17: 33717239 - 33718902
Public Clones IST11897G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32805
Vector Insertion
Chr 17: 33719382 - 33720629
Public Clones IST14978A5 (tigm) IST13670G2 (tigm) IST13749A8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33693
Vector Insertion
Chr 17: 33720922 - 33722537
Public Clones (sanger) IST13670G2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36817
Vector Insertion
Chr 17: 33722625 - 33723060
Public Clones IST14464D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30925
Vector Insertion
Chr 17: 33723229 - 33725047
Public Clones IST11640A8 (tigm) IST12296H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35993
Vector Insertion
Chr 17: 33729973 - 33730965
Public Clones IST10967C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33107
Vector Insertion
Chr 17: 33731313 - 33734885
Public Clones IST13519C9 (tigm) IST12981E9 (tigm) IST13659B8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32327
Vector Insertion
Chr 17: 33735001 - 33735087
Public Clones IST13999A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31666
Vector Insertion
Chr 17: 33735258 - 33737995
Public Clones (sanger) IST13829G8 (tigm) IST10960H6 (tigm) IST14931A11 (tigm) IST14252B1 (tigm)
IST12015C9 (tigm) IST14349E2 (tigm) IST10983H4 (tigm) IST13169F1 (tigm)
IST11629E3 (tigm) IST10067E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21717
Vector Insertion
Chr 17: 33738142 - 33738603
Public Clones not available
Private Clones OST320305 (lexicon)
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36125
Vector Insertion
Chr 17: 33738751 - 33738886
Public Clones IST12315D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15563
Vector Insertion
Chr 17: 33739036 - 33739470
Public Clones PST6056-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114400
Sequence
GGCAGCAAGGAGCGCTTTCACTGGCAGAGTCACAACGTGAAGCAGAGTGGAGTGGATGACATGGTGCTGCTGCCCCAGATCACCGAGGACGCCATTGTGA

GCAACCTCCGCAAACGCTTCATGGATGACTACATTTTT ACATACATTGGCTCAGTGCTAATCTCTGTAAACCCCTTCAAGCAGATGCCCTACTTCACTG

ACCGAGAAATTGACCTCTATCAGGGCGCG GCTCAATATGAGAATCCCCCGCACATCTATGCCCTCACCGACAACATGTACCGGAATATGCTGATCGACT

GTGAGAACCAGTGTGTCATTATCAG TGGGGAGAGCGGAGCTGGGAAGACAGTGGCTGCTAAATACATCATGGGCTACATCTCCAAGGTGTCTGGTGGGG

GAGACAAGGTCCAG CACGTCAAAGACATAATCCTACAGTCAAACCCACTGCTTGAGGCTTTCGGCAATGCCAAGACCGTGCGCAACAACAATTCCAGCC

GCTTT GGCAAGTACTTTGAGATCCAGTTCAGTCGAGGTGGAGAGCCAGATGGAGGCAAGATCTCCAACTTCCTGCTGGAAAAGTCTCGTGTGGTCATGC

AGAATGAGAATGAGAGGAACTTCCACATCTACTACCAG CTTCTGGAAGGGGCCTCCCAGGAGCAGCAGCAGAACCTAGGACTCATGACGCCAGACTACT

ACTACTACCTCAACCAATCAGACACCTACAAGGTGGAAGGCACTGATGACCGAAGTGACTTCAGCGAGACCCTG - UNI34483 - AGCGCCATGCAA

GTCATCGGGATTCCGACAAGCGTGCAGCAGCTTGTCTTGCAGCTCGTGGCAGGGATCTTGCACCTGGGGAACATCAGCTTCTGTGAAGAAGGGAATTATG

CCCGCGTGGAGAGCGTAGACC TCTTAGCTTTCCCAGCCTACCTGCTGGGCATAGACAGTGGGCGGCTGCAAGAGAAGCTGACCAGCCGTAAGATGGACA

GCAAATGGGGTGGACGCAGTGAGTCCATTGATGTGACCCTCAATGTGGAACAGGCAGCCTACACTCGTGACGCACTGGCCAAGGGACTCTATGCCCGCCT

CTTCGACTTCCTGGTGGAG - UNI32805 - GCCATCAACCGTGCCATGCAGAAGCCTCAGGAAGAATACAGCATCGGCGTGCTTGACATCTACGGCT

TTGAGATCTTCCAG AAAAATGGCTTTGAGCAGTTCTGCATCAACTTCGTCAATGAAAAGCTGCAGCAGATTTTTATTGAGCTCACGCTGAAGGCAGAGC

AG - UNI33693 - GAGGAGTATGTGCAAGAGGGCATCCGCTGGACCCCCATCGAATACTTCAACAACAAAATTGTGTGTGACCTCATCGAAAACAAG

CTG AGCCCCCCAGGCATCATGAGCGTGCTAGATGATGTGTGTGCCACGATGCATGCTACCGGTGGCGGCGCGGACCAGACACTGCTACAAAAGCTGCAA

GCGGCAGTGGGCACCCACGAGCACTTCAACAGCTGGAGCGCGGGTTTCGTCATCCATCACTATGCAGGCAAG - UNI30925 - GTCTCCTATGATGT

CAGTGGCTTCTGTGAGAGGAATCGAGATGTGCTGTTCTCTGATCTTATAGAACTGATGCAGTCCAGTGACCA GGACTTCCTACGGATGCTCTTTCCTGA

GAAGCTGAATATAGACAAGAAGGGCCGCCCCAGTACTGCTGGCTCCAAGATCAAG AAACAAGCCAACGACCTGGTGTCCACGCTGAAGAAGTGCACACC

CCACTACATCCGCTGCATCAAACCTAACGAGACCAAGCGTCCCCGGGACTGGGAGGAAAGCAG - UNI35993 - AGTGAAGCACCAGGTGGAGTACC

TGGGCCTGCGGGAGAACATCCGAGTGCGAAGGGCAGGCTTCGCCTACCGTCGGCAGTTCTCCAAATTCCTGCAAAG GTATGCCATCCTGACCCCTGAGA

CATGGCCACGGTGGCGTGGAGATGAACGCCAGGGTGTCCAGCACCTGCTTCGTGCTGTCAACATGGAGCCAGACCAGTACCAGATGGGGAGTACCAAGGT

CTTTGTTAAGAATCCTGAGTCG - UNI33107 - CTTTTCCTCCTGGAAGAGATGCGAGAGAGGAAGTTTGACGGCTTCGCTCGCACTATCCAGAAAG

CCTGGCGGCGCCATGTAGCAGTCCGAAAGTATGAAGAGATGCGGGAAGAAG - UNI32327 - CTTCTAACATCCTACTGAACAAGAAGGAACGAAGG

CGAAACAGCATCAACCGTAACTTCGTTGGGGACTATCTGGGACTGGAGGAGCGGCCTGAGCTGCGCCAGTTCCTGGCTAAAAGGGAACGAGTGGACTTTG

CCGACTCAGTCACCAAGTATGACCGCCGCTTCAAG - UNI31666 - CCTATCAAACGGGACTTGATCCTGACCCCAAAGTGTGTGTATGTGATTGGG

AGAGAGAAGGTGAAAAGGGGACCAGAGAAGGGTCTAGTGCGTGAAGTCCTGAAGAAGAAACTGGATATCCAGGCCCTCCGAGGGGTGTCTCTCAG - UN

I21717 - CACCCGACAGGATGACTTCTTCATCCTTCAAGAAGAGGCTGCGGACAGCTTCTTAGAAAGTATCTTCAAGACCGAGTTTGTCAGCCTTCTG

TGCAAGCGTTTTGAAGAGGCAGCGCGCAGGCCCCTTCCCCTCACCTTCAGTGACCT - UNI36125 - ACTACAGTTCCGGGTGAAGAAAGAAGGCTG

GGGCGGAGGTAGTACCCGAAATGTCACCTTCTCTCGCGGGACAAGTGACTTGGCTGTGCTCAAGGCTGGGGGTCGAGCTCTCACTATCAGCATTGGGGAC

GGATTGCCTAAGAGCACCA - UNI15563 - AGCCTACACGGAAGGGGTTAGCCCAGGGTAGACCTCGAAGGTCAGCGCAGGCTCCCACTCGAGCA C

CCTGGGCCTCCCAGAG GATAAACAAAATTGGGAATACCT GTTTGAATCGAAATGGGGTACCACCCTCTTCCCAGGTAAGGTCCCTACCCCTG GAGTT

CCCAGAGGCCTCCACGGGGCCCTCCATCCTCAACCCTAGG GCCAGCAGACGTCCTCGAGCACGGCCACCTTCAGAGCACAGTACAGAATTCCTTAATGT

GCCTGACCAGGGTGTGGCAGG CATGCAAAGGAAGCGAAGTATAGGGCAGAGACCTGTGCCAGGAGTGGGCCGGCCTAAGCCCCAACCACGGACACATGG

CCCGAGGTGCCGGGCACTGTACCAATACATAGGCCAGGATGTGGATGAGCTGAGCTTTAACGTGAACGAAGTCATTGAGATCCTCATAGAAG ACTCTTC

TGGCTGGTGGAAGGGTCGGCTTCATGGCCAGGAAGGTCTCTTTCCAGGAAACTATGTGGAGAAGATCTGA
Translation
GSKERFHWQSHNVKQSGVDDMVLLPQITEDAIVSNLRKRFMDDYIF TYIGSVLISVNPFKQMPYFTDREIDLYQGA AQYENPPHIYALTDNMYRNMLI

DCENQCVIIS SGESGAGKTVAAKYIMGYISKVSGGGDKVQ HVKDIILQSNPLLEAFGNAKTVRNNNSSRF GKYFEIQFSRGGEPDGGKISNFLLEKS

RVVMQNENERNFHIYYQ LLEGASQEQQQNLGLMTPDYYYYLNQSDTYKVEGTDDRSDFSETL - UNI34483 - SAMQVIGIPTSVQQLVLQLVAGI

LHLGNISFCEEGNYARVESVDL LLAFPAYLLGIDSGRLQEKLTSRKMDSKWGGRSESIDVTLNVEQAAYTRDALAKGLYARLFDFLVE - UNI32805

 - AINRAMQKPQEEYSIGVLDIYGFEIFQ KNGFEQFCINFVNEKLQQIFIELTLKAEQ - UNI33693 - EEYVQEGIRWTPIEYFNNKIVCDLIE

NKL SPPGIMSVLDDVCATMHATGGGADQTLLQKLQAAVGTHEHFNSWSAGFVIHHYAGK - UNI30925 - VSYDVSGFCERNRDVLFSDLIELMQS

SDQ QDFLRMLFPEKLNIDKKGRPSTAGSKIK KQANDLVSTLKKCTPHYIRCIKPNETKRPRDWEESR - UNI35993 - RVKHQVEYLGLRENIRV

RRAGFAYRRQFSKFLQR RYAILTPETWPRWRGDERQGVQHLLRAVNMEPDQYQMGSTKVFVKNPES - UNI33107 - LFLLEEMRERKFDGFARTI

QKAWRRHVAVRKYEEMREEA - UNI32327 - ASNILLNKKERRRNSINRNFVGDYLGLEERPELRQFLAKRERVDFADSVTKYDRRFK - UNI316

66 - PIKRDLILTPKCVYVIGREKVKRGPEKGLVREVLKKKLDIQALRGVSLS - UNI21717 - STRQDDFFILQEEAADSFLESIFKTEFVSLLC

KRFEEAARRPLPLTFSDL - UNI36125 - LLQFRVKKEGWGGGSTRNVTFSRGTSDLAVLKAGGRALTISIGDGLPKSTK - UNI15563 - KPT

RKGLAQGRPRRSAQAPTRA PWASQR RINKIGNTC CLNRNGVPPSSQVRSLPL EFPEASTGPSILNPR ASRRPRARPPSEHSTEFLNVPDQGVAG 

GMQRKRSIGQRPVPGVGRPKPQPRTHGPRCRALYQYIGQDVDELSFNVNEVIEILIED DSSGWWKGRLHGQEGLFPGNYVEKI
Transcript ENSMUST00000087605
Sequence
AAAGAGGGGCTGTTACAAGAGGAACTAGGGCCAAGAGCCTGTGAAGGAGGAGAGCCATGCCAGAGCCACCCCCTAGAACCCTCTGAGCCTGCACCCCTGT

CATTACCCACAGGAGCCTACATACCATCCCTCACCATG - UNI36651 - GGCAGCAAGGAGCGCTTTCACTGGCAGAGTCACAACGTGAAGCAGAGT

GGAGTGGATGACATGGTGCTGCTGCCCCAGATCACCGAGGACGCCATTGTGAGCAACCTCCGCAAACGCTTCATGGATGACTACATTTTT ACATACATT

GGCTCAGTGCTAATCTCTGTAAACCCCTTCAAGCAGATGCCCTACTTCACTGACCGAGAAATTGACCTCTATCAGGGCGCG GCTCAATATGAGAATCCC

CCGCACATCTATGCCCTCACCGACAACATGTACCGGAATATGCTGATCGACTGTGAGAACCAGTGTGTCATTATCAG TGGGGAGAGCGGAGCTGGGAAG

ACAGTGGCTGCTAAATACATCATGGGCTACATCTCCAAGGTGTCTGGTGGGGGAGACAAGGTCCAG CACGTCAAAGACATAATCCTACAGTCAAACCCA

CTGCTTGAGGCTTTCGGCAATGCCAAGACCGTGCGCAACAACAATTCCAGCCGCTTT GGCAAGTACTTTGAGATCCAGTTCAGTCGAGGTGGAGAGCCA

GATGGAGGCAAGATCTCCAACTTCCTGCTGGAAAAGTCTCGTGTGGTCATGCAGAATGAGAATGAGAGGAACTTCCACATCTACTACCAG CTTCTGGAA

GGGGCCTCCCAGGAGCAGCAGCAGAACCTAGGACTCATGACGCCAGACTACTACTACTACCTCAACCAATCAGACACCTACAAGGTGGAAGGCACTGATG

ACCGAAGTGACTTCAGCGAGACCCTG - UNI34483 - AGCGCCATGCAAGTCATCGGGATTCCGACAAGCGTGCAGCAGCTTGTCTTGCAGCTCGTG

GCAGGGATCTTGCACCTGGGGAACATCAGCTTCTGTGAAGAAGGGAATTATGCCCGCGTGGAGAGCGTAGACC TCTTAGCTTTCCCAGCCTACCTGCTG

GGCATAGACAGTGGGCGGCTGCAAGAGAAGCTGACCAGCCGTAAGATGGACAGCAAATGGGGTGGACGCAGTGAGTCCATTGATGTGACCCTCAATGTGG

AACAGGCAGCCTACACTCGTGACGCACTGGCCAAGGGACTCTATGCCCGCCTCTTCGACTTCCTGGTGGAG - UNI32805 - GCCATCAACCGTGCC

ATGCAGAAGCCTCAGGAAGAATACAGCATCGGCGTGCTTGACATCTACGGCTTTGAGATCTTCCAG AAAAATGGCTTTGAGCAGTTCTGCATCAACTTC

GTCAATGAAAAGCTGCAGCAGATTTTTATTGAGCTCACGCTGAAGGCAGAGCAG - UNI33693 - GAGGAGTATGTGCAAGAGGGCATCCGCTGGAC

CCCCATCGAATACTTCAACAACAAAATTGTGTGTGACCTCATCGAAAACAAGCTG AGCCCCCCAGGCATCATGAGCGTGCTAGATGATGTGTGTGCCAC

GATGCATGCTACCGGTGGCGGCGCGGACCAGACACTGCTACAAAAGCTGCAAGCGGCAGTGGGCACCCACGAGCACTTCAACAGCTGGAGCGCGGGTTTC

GTCATCCATCACTATGCAGGCAAG - UNI30925 - GTCTCCTATGATGTCAGTGGCTTCTGTGAGAGGAATCGAGATGTGCTGTTCTCTGATCTTAT

AGAACTGATGCAGTCCAGTGACCA GGACTTCCTACGGATGCTCTTTCCTGAGAAGCTGAATATAGACAAGAAGGGCCGCCCCAGTACTGCTGGCTCCAA

GATCAAG AAACAAGCCAACGACCTGGTGTCCACGCTGAAGAAGTGCACACCCCACTACATCCGCTGCATCAAACCTAACGAGACCAAGCGTCCCCGGGA

CTGGGAGGAAAGCAG - UNI35993 - AGTGAAGCACCAGGTGGAGTACCTGGGCCTGCGGGAGAACATCCGAGTGCGAAGGGCAGGCTTCGCCTACC

GTCGGCAGTTCTCCAAATTCCTGCAAAG GTATGCCATCCTGACCCCTGAGACATGGCCACGGTGGCGTGGAGATGAACGCCAGGGTGTCCAGCACCTGC

TTCGTGCTGTCAACATGGAGCCAGACCAGTACCAGATGGGGAGTACCAAGGTCTTTGTTAAGAATCCTGAGTCG - UNI33107 - CTTTTCCTCCTG

GAAGAGATGCGAGAGAGGAAGTTTGACGGCTTCGCTCGCACTATCCAGAAAGCCTGGCGGCGCCATGTAGCAGTCCGAAAGTATGAAGAGATGCGGGAAG

AAG - UNI32327 - CTTCTAACATCCTACTGAACAAGAAGGAACGAAGGCGAAACAGCATCAACCGTAACTTCGTTGGGGACTATCTGGGACTGGAG

GAGCGGCCTGAGCTGCGCCAGTTCCTGGCTAAAAGGGAACGAGTGGACTTTGCCGACTCAGTCACCAAGTATGACCGCCGCTTCAAG - UNI31666 -

 CCTATCAAACGGGACTTGATCCTGACCCCAAAGTGTGTGTATGTGATTGGGAGAGAGAAGGTGAAAAGGGGACCAGAGAAGGGTCTAGTGCGTGAAGTC

CTGAAGAAGAAACTGGATATCCAGGCCCTCCGAGGGGTGTCTCTCAG - UNI21717 - CACCCGACAGGATGACTTCTTCATCCTTCAAGAAGAGGC

TGCGGACAGCTTCTTAGAAAGTATCTTCAAGACCGAGTTTGTCAGCCTTCTGTGCAAGCGTTTTGAAGAGGCAGCGCGCAGGCCCCTTCCCCTCACCTTC

AGTGACCT - UNI36125 - ACTACAGTTCCGGGTGAAGAAAGAAGGCTGGGGCGGAGGTAGTACCCGAAATGTCACCTTCTCTCGCGGGACAAGTGA

CTTGGCTGTGCTCAAGGCTGGGGGTCGAGCTCTCACTATCAGCATTGGGGACGGATTGCCTAAGAGCACCA - UNI15563 - AGCCTACACGGAAGG

GGTTAGCCCAGGGTAGACCTCGAAGGTCAGCGCAGGCTCCCACTCGAGCAGCCCCTGGGCCTCCCAGAG GTTTGAATCGAAATGGGGTACCACCCTCTT

CCCAGGTAAGGTCCCTACCCCTGGAGATCACATCTGGTAGGAGTTCCCAGAGGCCTCCACGGGGCCCTCCATCCTCAACCCTAGGAGCCAGCAGACGTCC

TCGAGCACGGCCACCTTCAGAGCACAGTACAGAATTCCTTAATGTGCCTGACCAGGGTGTGGCAGG CATGCAAAGGAAGCGAAGTATAGGGCAGAGACC

TGTGCCAGGAGTGGGCCGGCCTAAGCCCCAACCACGGACACATGGCCCGAGGTGCCGGGCACTGTACCAATACATAGGCCAGGATGTGGATGAGCTGAGC

TTTAACGTGAACGAAGTCATTGAGATCCTCATAGAAG ACTCTTCTGGCTGGTGGAAGGGTCGGCTTCATGGCCAGGAAGGTCTCTTTCCAGGAAACTAT

GTGGAGAAGATCTGATCGTCCATCCACCAGCCTGCCTGCTTGCCTGCCTGGGATCCAAACCCTGCCAGTGGAAGCCTTGGTTATCTTATCTGCACTGGCC

AGAATACTCAGGCTGTGGCCTCAAGCCCAGTGGGACCCCTGTGTATGGAGGATGAGCACTGTAGCACCCCATGCCTGGTACTGCCTTCCTGTGGGTTGAC

TTGCTATCTAAGTCTCCATTTTCTCCTGTGTCCAATAGTAGTTGCTGCAAAACCTACCTCCCAGCTGCCTTGTGTGTATGTAACAAATCATGTCCTGCCC

TGGGAGCAAAGTGCTGTGCACTGCCCAGAGTTAGGAGACGTGGACAGTTAGACCTTTCCACTTTCTCTCATCACTGAGGTAATAAACATGTGTCAAGT
Translation
M - UNI36651 - GSKERFHWQSHNVKQSGVDDMVLLPQITEDAIVSNLRKRFMDDYIF TYIGSVLISVNPFKQMPYFTDREIDLYQGA AQYENPP

HIYALTDNMYRNMLIDCENQCVIIS SGESGAGKTVAAKYIMGYISKVSGGGDKVQ HVKDIILQSNPLLEAFGNAKTVRNNNSSRF GKYFEIQFSRGG

EPDGGKISNFLLEKSRVVMQNENERNFHIYYQ LLEGASQEQQQNLGLMTPDYYYYLNQSDTYKVEGTDDRSDFSETL - UNI34483 - SAMQVIGI

PTSVQQLVLQLVAGILHLGNISFCEEGNYARVESVDL LLAFPAYLLGIDSGRLQEKLTSRKMDSKWGGRSESIDVTLNVEQAAYTRDALAKGLYARLFD

FLVE - UNI32805 - AINRAMQKPQEEYSIGVLDIYGFEIFQ KNGFEQFCINFVNEKLQQIFIELTLKAEQ - UNI33693 - EEYVQEGIRWT

PIEYFNNKIVCDLIENKL SPPGIMSVLDDVCATMHATGGGADQTLLQKLQAAVGTHEHFNSWSAGFVIHHYAGK - UNI30925 - VSYDVSGFCER

NRDVLFSDLIELMQSSDQ QDFLRMLFPEKLNIDKKGRPSTAGSKIK KQANDLVSTLKKCTPHYIRCIKPNETKRPRDWEESR - UNI35993 - RV

KHQVEYLGLRENIRVRRAGFAYRRQFSKFLQR RYAILTPETWPRWRGDERQGVQHLLRAVNMEPDQYQMGSTKVFVKNPES - UNI33107 - LFLL

EEMRERKFDGFARTIQKAWRRHVAVRKYEEMREEA - UNI32327 - ASNILLNKKERRRNSINRNFVGDYLGLEERPELRQFLAKRERVDFADSVTK

YDRRFK - UNI31666 - PIKRDLILTPKCVYVIGREKVKRGPEKGLVREVLKKKLDIQALRGVSLS - UNI21717 - STRQDDFFILQEEAADS

FLESIFKTEFVSLLCKRFEEAARRPLPLTFSDL - UNI36125 - LLQFRVKKEGWGGGSTRNVTFSRGTSDLAVLKAGGRALTISIGDGLPKSTK -

 UNI15563 - KPTRKGLAQGRPRRSAQAPTRAAPGPPRG GLNRNGVPPSSQVRSLPLEITSGRSSQRPPRGPPSSTLGASRRPRARPPSEHSTEFLN

VPDQGVAG GMQRKRSIGQRPVPGVGRPKPQPRTHGPRCRALYQYIGQDVDELSFNVNEVIEILIED DSSGWWKGRLHGQEGLFPGNYVEKI

For any suggestions or comments, please send an email to unitrap@crg.es