Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024301 (AC144621.3-201)
Chromosomal location
Chr 17: 27054036 - 27069524 (+)
Description
kinesin family member C1  [Source:RefSeq peptide;Acc:NP_444403]
RefSeq_dna
NM_053173 
RefSeq_peptide
NP_444403.2 
UniGene
Mm.416539 Mm.335713 Mm.458228 
Uniprot/SPTREMBL
Q5BJ94 Q9JKY9 
Human Ortholog
ENSG00000204197 (KIFC1)
Omim not available
UniTrap UNI4867
Vector Insertion
Chr 17: 27054231 - 27057849
Public Clones AE0727 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23466
Vector Insertion
Chr 17: 27054231 - 27057741
Public Clones not available
Private Clones OST258399 (lexicon) OST195949 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29348
Vector Insertion
Chr 17: 27058065 - 27058751
Public Clones PSTVU01.E2E (vanderbilt)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15118
Vector Insertion
Chr 17: 27059669 - 27059849
Public Clones PST12734-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31356
Vector Insertion
Chr 17: 27062845 - 27063164
Public Clones IST13430H10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4792
Vector Insertion
Chr 17: 27063241 - 27069048
Public Clones AW0100 (sanger) IST10265H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088099
Sequence
ATGGAGGATGCCTTGGAGCCTGCAAAG AAACGGACACGAGTCATGGGTGCAGTGACCAAAGTTGACACATCCCGTCCCAGAGGACCACTCCTCAGCACA

GTGTCACAGACCCAGGGCCACAATGCAG - UNI29348 - CTCAGAAAGGCCCTAAGAAGACAGGACCTGGTGGGTGCTCTGCTGTTGGTACAG TGC

TGAGGAGCCAGAAGCCAGCTCCCGCTGCTCCTGCGAAGCCTGGCA - UNI15118 - CATCCACTGCTCCTGTGGTGGTAGGGAAGAGAGCTGGCAAA

CGCCCTGCCTGGGACCTGAAGGGCCAGTTGTGTGACCTCAATGAAGAGTTGAAACGCTATCGGGAGAAGACTGAAACGCTGGAACTGGAGAACCGGGGTC

TTCGGGAGCAACTCAGAGAGGTCCAGGAGCAGGCCACGACCCTGGGGACAGAGCGGAACACCCTGGAAGGGGAGCTGGCCAGTGTACGCAGCCGAGCTGA

GCAG GGAAAGGCTGCTTCAGGAGCTTCAGGGAGAGCGGCTGCAATTGCAGGAGGAGCG ACACTGAGCACCCAACTGGAGGAGCAGGAG AGGAGGTTT

CAGGCCACAGAAGCAGCTCTGTCAAGCAGCCAAGAAGAGGTGGTGTGTCTTCGGCAGAAGACTGAAGCCCAGGTGACCTTACTGGCTGAGCAAGGAGACC

GGCTCTATGGGTTAGAGATGGAGCGGCGGCGACTCCACAACCAGCTGCAGGAACTGAAGGGCAATATCCGGGTGTTCTGCCGCGTGCGCCCTGTCCTCGA

AGGGGAATCCACTCCATCTCCTGGCTTCCTCGTGTTTCCTCCTGGCCCTGCTGGACCCTCTGATCGCCCGACGGGCCTTAGCCTCTCACGATCTGATGAT

CGGCGCTCCACCCTGACTGGGGCCCCGGCACCCACTGTCCGCCATGATTTCTCCTTTGATCGGGTGTTCCCGCCGGGAAGCAAGCAGGAGGAAGTGTTTG

AGGAGATCGCCATGCTTGTCCAGTCAGCACTAGATGGCTACCCTGTGTGCATTTTTGCCTATGGACAGACAGGCAGTGGCAAGACCTTCACTATGGAAGG

AGGGCCTAGGGGAGACCCCCAATTGGCAGGGCTGATCCCTCGGGCCATGCGGCATCTGTTCTCTGTGGCCCAGGAGATGAGCGGCCAGGGCTGGACATAC

AGTTTTGTGGCGAGTTACGTAGAGATCTACAATGAGACCGTTCGAGACCTGCTAGCTACTGGGCCCCGCAAGGGACAAGGGGGCGAGTGCGAGATCCGTC

GGGCAAGCCCAGGGAGTGAGGAGCTTACTGTCACCAATGCCCGCTATGTCCCTGTTTCCTGTGAGAAAGAG GTGGAGGCCCTGCTCCATTTGGCTCACC

AGAACCGGGCTGTGGCCCACACTGCCCAGAATAAGAGATCATCACGCAGTCATAGTGTGTTCCAGCTGCAGATTTCTGGAGAGCATGCAGCCCGGGGCCT

GCAGTGTGGCGCTCCCCTCAACCTTGTGGACCTAGCTGGGAGTGAGCGGCTAGACCCTGGCTTACCCCTAGGCCCTGGGGAGCGTGATCGTCTTCGGGAG

ACACAGGCCATTAACAGCAGTCTGTCTACATTGGGACTGGTCATAATGGCCCTGAGCAATAAG GAGTCCCACGTGCCTTACCGAAACAGCAAGCTCACC

TACTTGCTGCAGAACTCTCTGGGTGGCAGTGCCAAGAT - UNI31356 - GCTTATGTTTGTGAATATTTCTCCTCTGGAAGAGAATGTCTCCGAGTC

TCTGAATTCACTACGCTTTGCTTCCAAG - UNI4792 - GTGAACCAGTGTGTCATTGGTACTGCTCAGGCTAATAAGAAGTGA
Translation
MEDALEPAK KRTRVMGAVTKVDTSRPRGPLLSTVSQTQGHNAA - UNI29348 - AQKGPKKTGPGGCSAVGTV VLRSQKPAPAAPAKPGT - UN

I15118 - TSTAPVVVGKRAGKRPAWDLKGQLCDLNEELKRYREKTETLELENRGLREQLREVQEQATTLGTERNTLEGELASVRSRAEQ GKAASGAS

GRAAAIAGGA TLSTQLEEQE RRFQATEAALSSSQEEVVCLRQKTEAQVTLLAEQGDRLYGLEMERRRLHNQLQELKGNIRVFCRVRPVLEGESTPSPG

FLVFPPGPAGPSDRPTGLSLSRSDDRRSTLTGAPAPTVRHDFSFDRVFPPGSKQEEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPRGDPQL

AGLIPRAMRHLFSVAQEMSGQGWTYSFVASYVEIYNETVRDLLATGPRKGQGGECEIRRASPGSEELTVTNARYVPVSCEKE VEALLHLAHQNRAVAHT

AQNKRSSRSHSVFQLQISGEHAARGLQCGAPLNLVDLAGSERLDPGLPLGPGERDRLRETQAINSSLSTLGLVIMALSNK ESHVPYRNSKLTYLLQNSL

GGSAKM - UNI31356 - MLMFVNISPLEENVSESLNSLRFASK - UNI4792 - VNQCVIGTAQANKK
Transcript ENSMUST00000077674
Sequence
GAAGTGCGTTGACTGCGCGGAGGTTGAAATTCAAAAGTGACTGGTGTGGCGGATTGGCTTGGCCGATTGGCCTGGCGAATTGGCCTGGCTCCGACGTTTT

GCGGCGCGAGCCCTTGAGAGGACGCGGGTCTCGTCACCCTGCCTGCTGCCTTTGCATCCCTTCCTGTGCGGACCACCATGGACGTGCAGGCGCAG - UN

I4867 - - UNI23466 - AGAAAGGGAAGGGAAGGGAAGAGGAACGTAGAACTGAAGGCGGCCCTGGTCAAGTCCTCCTCCCGACTGCCCCTGTCAG

CAAGCAGCCTCAAGAGGGGTCCTGACCAGATGGAGGATGCCTTGGAGCCTGCAAAG AAACGGACACGAGTCATGGGTGCAGTGACCAAAGTTGACACAT

CCCGTCCCAGAGGACCACTCCTCAGCACAGTGTCACAGACCCAGGGCCACAATGCAG - UNI29348 - TGCTGAGGAGCCAGAAGCCAGCTCCCGCT

GCTCCTGCGAAGCCTGGCA - UNI15118 - CATCCACTGCTCCTGTGGTGGTAGGGAAGAGAGCTGGCAAACGCCCTGCCTGGGACCTGAAGGGCCA

GTTGTGTGACCTCAATGAAGAGTTGAAACGCTATCGGGAGAAGACTGAAACGCTGGAACTGGAGAACCGGGGTCTTCGGGAGCAACTCAGAGAGGTCCAG

GAGCAGGCCACGACCCTGGGGACAGAGCGGAACACCCTGGAAGGGGAGCTGGCCAGTGTACGCAGCCGAGCTGAGCAGGACCAGCAGAGGCTGGAGACGC

TGAGTGCCCGTGTCTTGGAGCTGGAGGAATGTCTGGGTACCAGGGAAAGGCTGCTTCAGGAGCTTCAGGGAGAGCGGCTGCAATTGCAGGAGGAGCGGAG

CACACTGAGCACCCAACTGGAGGAGCAGGAG AGGAGGTTTCAGGCCACAGAAGCAGCTCTGTCAAGCAGCCAAGAAGAGGTGGTGTGTCTTCGGCAGAA

GACTGAAGCCCAGGTGACCTTACTGGCTGAGCAAGGAGACCGGCTCTATGGGTTAGAGATGGAGCGGCGGCGACTCCACAACCAGCTGCAGGAACTGAAG

GGCAATATCCGGGTGTTCTGCCGCGTGCGCCCTGTCCTCGAAGGGGAATCCACTCCATCTCCTGGCTTCCTCGTGTTTCCTCCTGGCCCTGCTGGACCCT

CTGATCGCCCGACGGGCCTTAGCCTCTCACGATCTGATGATCGGCGCTCCACCCTGACTGGGGCCCCGGCACCCACTGTCCGCCATGATTTCTCCTTTGA

TCGGGTGTTCCCGCCGGGAAGCAAGCAGGAGGAAGTGTTTGAGGAGATCGCCATGCTTGTCCAGTCAGCACTAGATGGCTACCCTGTGTGCATTTTTGCC

TATGGACAGACAGGCAGTGGCAAGACCTTCACTATGGAAGGAGGGCCTAGGGGAGACCCCCAATTGGCAGGGCTGATCCCTCGGGCCATGCGGCATCTGT

TCTCTGTGGCCCAGGAGATGAGCGGCCAGGGCTGGACATACAGTTTTGTGGCGAGTTACGTAGAGATCTACAATGAGACCGTTCGAGACCTGCTAGCTAC

TGGGCCCCGCAAGGGACAAGGGGGCGAGTGCGAGATCCGTCGGGCAAGCCCAGGGAGTGAGGAGCTTACTGTCACCAATGCCCGCTATGTCCCTGTTTCC

TGTGAGAAAGAG GTGGAGGCCCTGCTCCATTTGGCTCACCAGAACCGGGCTGTGGCCCACACTGCCCAGAATAAGAGATCATCACGCAGTCATAGTGTG

TTCCAGCTGCAGATTTCTGGAGAGCATGCAGCCCGGGGCCTGCAGTGTGGCGCTCCCCTCAACCTTGTGGACCTAGCTGGGAGTGAGCGGCTAGACCCTG

GCTTACCCCTAGGCCCTGGGGAGCGTGATCGTCTTCGGGAGACACAGGCCATTAACAGCAGTCTGTCTACATTGGGACTGGTCATAATGGCCCTGAGCAA

TAAG GAGTCCCACGTGCCTTACCGAAACAGCAAGCTCACCTACTTGCTGCAGAACTCTCTGGGTGGCAGTGCCAAGAT - UNI31356 - GCTTATG

TTTGTGAATATTTCTCCTCTGGAAGAGAATGTCTCCGAGTCTCTGAATTCACTACGCTTTGCTTCCAAG - UNI4792 - GTGAACCAGTGTGTCATT

GGTACTGCTCAGGCTAATAAGAAGTGAAGTCGGATCCAGAGCCCTTGCAAGCCAGTGCGCATGCGTCTCTGTTTTAGTGTGTATTTATTCGGTGGGGGTG

GGTGGGAGTTGAGACATGATATTACTGGGTATTTATTATGTAATAAAGAATAATCTTTTGTATGTTAATCCTTTTCTTAATCTTAGATTTTAAAAAATTG

TGTGCAGTTGTTTTGCCTGAGTGTATATGCATGCACCATGTGCATGTCTCCTGCTCCAGTGAGTTCAGAACAGGGCTTCAGGTCCTTCAAGAACTGGGAT

TATGGAATACATGTGGGTCCTCTGCAAAATCAGTCAGTGCTCTTAACCGCCCAGCCATCTTCCCAGCCCGGCCCTTGTTACAGCTCTAAACGGTTTTATT

AACTTAACGGTTTTAGCTGCCAAAGGAAGGTATTGTAAATAAATACTGTAAGCACGTA
Translation
MDVQAQ - UNI4867 - - UNI23466 - RKGREGKRNVELKAALVKSSSRLPLSASSLKRGPDQMEDALEPAK KRTRVMGAVTKVDTSRPRGPLL

STVSQTQGHNAV - UNI29348 - VLRSQKPAPAAPAKPGT - UNI15118 - TSTAPVVVGKRAGKRPAWDLKGQLCDLNEELKRYREKTETLEL

ENRGLREQLREVQEQATTLGTERNTLEGELASVRSRAEQDQQRLETLSARVLELEECLGTRERLLQELQGERLQLQEERSTLSTQLEEQE RRFQATEAA

LSSSQEEVVCLRQKTEAQVTLLAEQGDRLYGLEMERRRLHNQLQELKGNIRVFCRVRPVLEGESTPSPGFLVFPPGPAGPSDRPTGLSLSRSDDRRSTLT

GAPAPTVRHDFSFDRVFPPGSKQEEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPRGDPQLAGLIPRAMRHLFSVAQEMSGQGWTYSFVASY

VEIYNETVRDLLATGPRKGQGGECEIRRASPGSEELTVTNARYVPVSCEKE VEALLHLAHQNRAVAHTAQNKRSSRSHSVFQLQISGEHAARGLQCGAP

LNLVDLAGSERLDPGLPLGPGERDRLRETQAINSSLSTLGLVIMALSNK ESHVPYRNSKLTYLLQNSLGGSAKM - UNI31356 - MLMFVNISPLE

ENVSESLNSLRFASK - UNI4792 - VNQCVIGTAQANKK
Transcript ENSMUST00000078961
Sequence
GAAGTGCGTTGACTGCGCGGAGGTTGAAATTCAAAAGTGACTGGTGTGGCGGATTGGCTTGGCCGATTGGCCTGGCGAATTGGCCTGGCTCCGACGTTTT

GCGGCGCGAGCCCTTGAGAGGACGCGGGTCTCGTCACCCTGCCTGCTGCCTTTGCATCCCTTCCTGTGCGGACCACCATGGACGTGCAGGCGCAG - UN

I4867 - - UNI23466 - AGAAAGGGAAGGGAAGGGAAGAGGAACGTAGAACTGAAGGCGGCCCTGGTCAAGTCCTCCTCCCGACTGCCCCTGTCAG

CAAGCAGCCTCAAGAGGGGTCCTGACCAGATGGAGGATGCCTTGGAGCCTGCAAAG AAACGGACACGAGTCATGGGTGCAGTGACCAAAGTTGACACAT

CCCGTCCCAGAGGACCACTCCTCAGCACAGTGTCACAGACCCAGGGCCACAATGCAG - UNI29348 - CTCAGAAAGGCCCTAAGAAGACAGGACCT

GGTGGGTGCTCTGCTGTTGGTACAG TGCTGAGGAGCCAGAAGCCAGCTCCCGCTGCTCCTGCGAAGCCTGGCA - UNI15118 - CATCCACTGCTC

CTGTGGTGGTAGGGAAGAGAGCTGGCAAACGCCCTGCCTGGGACCTGAAGGGCCAGTTGTGTGACCTCAATGAAGAGTTGAAACGCTATCGGGAGAAGAC

TGAAACGCTGGAACTGGAGAACCGGGGTCTTCGGGAGCAACTCAGAGAGGTCCAGGAGCAGGCCACGACCCTGGGGACAGAGCGGAACACCCTGGAAGGG

GAGCTGGCCAGTGTACGCAGCCGAGCTGAGCAGGACCAGCAGAGGCTGGAGACGCTGAGTGCCCGTGTCTTGGAGCTGGAGGAATGTCTGGGTACCAGGG

AAAGGCTGCTTCAGGAGCTTCAGGGAGAGCGGCTGCAATTGCAGGAGGAGCGGAGCACACTGAGCACCCAACTGGAGGAGCAGGAG AGGAGGTTTCAGG

CCACAGAAGCAGCTCTGTCAAGCAGCCAAGAAGAGGTGGTGTGTCTTCGGCAGAAGACTGAAGCCCAGGTGACCTTACTGGCTGAGCAAGGAGACCGGCT

CTATGGGTTAGAGATGGAGCGGCGGCGACTCCACAACCAGCTGCAGGAACTGAAGGGCAATATCCGGGTGTTCTGCCGCGTGCGCCCTGTCCTCGAAGGG

GAATCCACTCCATCTCCTGGCTTCCTCGTGTTTCCTCCTGGCCCTGCTGGACCCTCTGATCGCCCGACGGGCCTTAGCCTCTCACGATCTGATGATCGGC

GCTCCACCCTGACTGGGGCCCCGGCACCCACTGTCCGCCATGATTTCTCCTTTGATCGGGTGTTCCCGCCGGGAAGCAAGCAGGAGGAAGTGTTTGAGGA

GATCGCCATGCTTGTCCAGTCAGCACTAGATGGCTACCCTGTGTGCATTTTTGCCTATGGACAGACAGGCAGTGGCAAGACCTTCACTATGGAAGGAGGG

CCTAGGGGAGACCCCCAATTGGCAGGGCTGATCCCTCGGGCCATGCGGCATCTGTTCTCTGTGGCCCAGGAGATGAGCGGCCAGGGCTGGACATACAGTT

TTGTGGCGAGTTACGTAGAGATCTACAATGAGACCGTTCGAGACCTGCTAGCTACTGGGCCCCGCAAGGGACAAGGGGGCGAGTGCGAGATCCGTCGGGC

AAGCCCAGGGAGTGAGGAGCTTACTGTCACCAATGCCCGCTATGTCCCTGTTTCCTGTGAGAAAGAG GTGGAGGCCCTGCTCCATTTGGCTCACCAGAA

CCGGGCTGTGGCCCACACTGCCCAGAATAAGAGATCATCACGCAGTCATAGTGTGTTCCAGCTGCAGATTTCTGGAGAGCATGCAGCCCGGGGCCTGCAG

TGTGGCGCTCCCCTCAACCTTGTGGACCTAGCTGGGAGTGAGCGGCTAGACCCTGGCTTACCCCTAGGCCCTGGGGAGCGTGATCGTCTTCGGGAGACAC

AGGCCATTAACAGCAGTCTGTCTACATTGGGACTGGTCATAATGGCCCTGAGCAATAAG GAGTCCCACGTGCCTTACCGAAACAGCAAGCTCACCTACT

TGCTGCAGAACTCTCTGGGTGGCAGTGCCAAGAT - UNI31356 - GCTTATGTTTGTGAATATTTCTCCTCTGGAAGAGAATGTCTCCGAGTCTCTG

AATTCACTACGCTTTGCTTCCAAG - UNI4792 - GTGAACCAGTGTGTCATTGGTACTGCTCAGGCTAATAAGAAGTGAAGTCGGATCCAGAGCCCT

TGCAAGCCAGTGCGCATGCGTCTCTGTTTTAGTGTGTATTTATTCGGTGGGGGTGGGTGGGAGTTGAGACATGATATTACTGGGTATTTATTATGTAATA

AAGAATAATCTTTTGTATGTTAATCCTTTTCTTAATCTTAGATTTTAAAAAATTGTGTGCAGTTGTTTTGCCTGAGTGTATATGCATGCACCATGTGCAT

GTCTCCTGCTCCAGTGAGTTCAGAACAGGGCTTCAGGTCCTTCAAGAACTGGGATTATGGAATACATGTGGGTCCTCTGCAAAATCAGTCAGTGCTCTTA

ACCGCCCAGCCATCTTCCCAGCCCGGCCCTTGTTACAGCTCTAAACGGTTTTATTAACTTAACGGTTTTAGCTGCCAAAGGAAGGTATTGTAAATAAATA

CTGTAAGCACGTA
Translation
MDVQAQ - UNI4867 - - UNI23466 - RKGREGKRNVELKAALVKSSSRLPLSASSLKRGPDQMEDALEPAK KRTRVMGAVTKVDTSRPRGPLL

STVSQTQGHNAA - UNI29348 - AQKGPKKTGPGGCSAVGTV VLRSQKPAPAAPAKPGT - UNI15118 - TSTAPVVVGKRAGKRPAWDLKGQ

LCDLNEELKRYREKTETLELENRGLREQLREVQEQATTLGTERNTLEGELASVRSRAEQDQQRLETLSARVLELEECLGTRERLLQELQGERLQLQEERS

TLSTQLEEQE RRFQATEAALSSSQEEVVCLRQKTEAQVTLLAEQGDRLYGLEMERRRLHNQLQELKGNIRVFCRVRPVLEGESTPSPGFLVFPPGPAGP

SDRPTGLSLSRSDDRRSTLTGAPAPTVRHDFSFDRVFPPGSKQEEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPRGDPQLAGLIPRAMRHL

FSVAQEMSGQGWTYSFVASYVEIYNETVRDLLATGPRKGQGGECEIRRASPGSEELTVTNARYVPVSCEKE VEALLHLAHQNRAVAHTAQNKRSSRSHS

VFQLQISGEHAARGLQCGAPLNLVDLAGSERLDPGLPLGPGERDRLRETQAINSSLSTLGLVIMALSNK ESHVPYRNSKLTYLLQNSLGGSAKM - UN

I31356 - MLMFVNISPLEENVSESLNSLRFASK - UNI4792 - VNQCVIGTAQANKK

For any suggestions or comments, please send an email to unitrap@crg.es