Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024392 (Bat3)
Chromosomal location
Chr 17: 35272187 - 35284250 (+)
Description
HLA-B-associated transcript 3 Gene [Source:MGI Symbol;Acc:MGI:1919439]
RefSeq_dna
NM_057171 
RefSeq_peptide
NP_476512.1 
UniGene
Mm.203962 
MGI
MGI:1919439 
Uniprot/SWISSPROT
Q9Z1R2 
Uniprot/SPTREMBL
Q3TDL4 Q8HWH4 Q3UF95 Q9CRG8 
Human Ortholog
ENSG00000204463 (BAT3)
Omim not available
UniTrap UNI20427
Vector Insertion
Chr 17: 35272417 - 35273059
Public Clones not available
Private Clones OST363621 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26926
Vector Insertion
Chr 17: 35273181 - 35275316
Public Clones D076C07 (ggtc) D075D06 (ggtc) D075B05 (ggtc) D076E08 (ggtc) D075G09 (ggtc)
Private Clones OST85067 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25613
Vector Insertion
Chr 17: 35275435 - 35275530
Public Clones not available
Private Clones OST173915 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087274
Sequence
GCGGCGGCGGCTCCTCCGGGTGGTCGGCTCCCTCCCATCTCGGCCGGCCCGGGCCCGTCTCGCCCCCCAGAAACTCACTGTTCGGGGCTGTGGACTTTCT

CATCGTGCCCCACGAAAGTAAATCGGGGGAGACTGGGGGAGCCGGAAGTACCGCCTCGAGATCCCCCCAAATACGATCGGGGAAACGGAAGTGGCCCTTG

GTGCCAGGTTGGGGGAGACCGGAAGTGACG - UNI20427 - AGAGCTGTCGGCCATGGAGCCGAGTGATAGTGCCAGTACCGCTATGGAGGAGCCTG

ACAGCCTGGAGGTACTGGTGAAGACCCTGGACTCTCAGACTCGGACTTTTATTGTGGGGGCCCAG - UNI26926 - ATGAATGTAAAGGAGTTTAAG

GAACACATAGCTGCCTCTGTCAGCATCCCTTCCGAGAAACAGCGGCTCATCTACCAGGGCCGGGTCCTACAAGACGACAAGAAGCTCCAGGAGTACA - 

UNI25613 - ACGTTGGGGGAAAGGTTATTCACCTGGTGGAACGGGCTCCTCCTCAGACTCAGCTTCCTTCTGGAGCATCTTCTGGGACAGGCTCTGCC

TCAGCAACTCATGGTGGGGCACCCCTGCCTGGCACTCGGGGCCCTGGGGCTTCTGTTCATGACCGGAATGCCAACAGCTATGTCATGGTTGGAACCTTCA

ATCTTCCT AGTGACGGCTCTGCTGTGGATGTTCACATCAACATGGAACAGGCCCCAATTCAG AGTGAGCCCCGGGTCCGGCTGGTGATGGCTCAGCAC

ATGATTAGGGATATACAGACCTTACTGTCCCGGATGGAG TGTCGAGGGGGAACCCAAGCTCAGGCCAGTCAGCCACCCCCGCAGACACCGCAGACTGTG

GCCTCAGAGACGGTAGCCTTGAACTCACAAACATCAGAACCAGTCGAAAGTGAAGCTCCTCCTCGAGAGCCCATGGAGTCAGAAGAAATGGAGGAACGTC

CCCCAACCCAGACTCCAGAGCTTGCGCCCTCAGGCCCAGCTCCCGCAGGCCCAGCTCCCGCAGGCCCAGCTCCCGCGCCAGAGACAAATGCACCCAA CC

ACCCTTCCCCCGCAGAGCACGTGGAGGTGCTCCAGGAGCTTCAGCGCTTGCAGCGCCGTCTTCAGCCTTTCCTACAGCGCTACTGCGAGGTCCTGGGCGC

TGCTGCCACCACAGACTACAACAACAAC CATGAGGGCCGTGAGGAGGACCAGAGGTTGATCAACTTGGTTGGGGAGAGCCTGCGGCTACTGGGCAACAC

TTTCGTGGCATTGTCTGATCTGCGCTGCAATCTAGCCTGTGCACCCCCACGGCACCTGCACGTGGTTCGGCCTATGTCTCACTACACGACTCCCATGGTG

CTCCAGCAGGCAGCCATTCCCATTCAG ATCAATGTGGGGACTACTGTGACCATGACAGGCAATGGGGCTCGGCCTCCACCAGCTCCTGGTGCGGAGGCA

GCAACCCCAGGTTCTGCCCAGGCCACATCCCTGCCTCCCTCTTCCACCACTGTTGATTCATCAACTGAAGGAGCTCCCCCACCAGGGCCAGCACCGCCAC

CAGCCTCCAGCCACCCACGGGTCATCCGGATTTCCCACCAGAGTGTGGAGCCCGTGGTCATGATGCACATGAACATTCAAG ATTCTGGAGCACAGCCTG

GTGGTGTGCCAAGTGCTCCCACTGGTCCACTGGGACCTCCTGGTCATGGACAGACCCTGG GCTCCACCCTCATCCAGCTGCCCTCCCTGCCCCCTGAGT

TCATGCACGCCGTCGCCCACCAGATCACTCATCAGGCCATGGTGGCAGCTGTTGCCTCCGCGGCCGCAG GACAGCAGGTGCCCGGCTTCCCAACAGCAC

CAACTCGGGTGGTGATTGCCCGGCCAACTCCTCCACAGGCTCGGCCTTCCCATCCTGGGGGACCTCCAGTCTCTGGAGCTCTG GGCGCTGGGCTGGGTA

CAAACACTTCATTGGCCCAGATGGTGAGCGGCCTTGTGGGGCAACTTCTTATGCAGCCTGTTCTTGTGG CTCAGGGGACTCCAGGAATGGCTCAGGCTC

AGGCCCAGGCCCAGGCTCAGGCCCAGGCCCAGGCCCAGGCTCCAGCTCCGGCTCCGGCTCCAGCTCCAGCTCCTGCCACTGCTTCAGCTAGTGCTGGTAC

TACCAACACAGCTACCACAGCTGGCCCTGCTCCTGGGGGTCCTGCCCAGCCTCCACCTCCTCAGCCCTCTGCAGCTGATCTTCAGTTCTCTCAGCTCCTG

GGAAATCTGCTGGGGCCTGCAGGGCCAGGGGCTGGGGGGCCAGGCATGGCTTCTCCCACCATCACTGTGGCAATGCCTGGTGTCCCTGCTTTTCTCCAGG

GCATGACTGATTTTTTGCAG GCATCACAGACTGCCCCTCCACCCCCTCCACCTCCTCCACCCCCACCCCCTGCCCCAGAGCAGCAGAGCACACCCCCAC

CAGGGTCTCCTTCTGGTGGAACAGCAAGCCCTGGAGGCTTAGGTCCTGAGAGCCTGCCACCAGAGTTTTTCACCTCAGTGGTGCAGGGCGTGTTGAGCTC

CCTCCTGGGCTCCTTGGGGGCTCGAGCTGGCAGCAGTGAGAGTATCGCTGCCTTCATCCAACGCCTCAGTGGATCCAGCAACATCTTTGAGCCTGGGGCT

GATGGCGCCCTTG GATTCTTCGGAGCTCTGCTCTCTCTCCTGTGCCAGAATTTCTCCATGGTGGATGTGGTGATGCTTCTCCATGGCCATTTCCAGCCA

CTGCAGCGGCTCCAGCCACAGCTGCGATCTTTCTTCCACCAGCACTACCTGGGTGGCCAGGAGCCCACGCCTAGCAACATCCGG ATGGCGACCCACACA

CTGATCACTGGGCTGGAAGAGTATGTAAGGGAGAGTTTT TCTTTGGTACAGGTTCAGCCAGGTGTGGATATCATCCGGACAAATTTAGAATTTCTCCAA

GAGCAGTTTAACAGCATTGCTGCTCATGTGCTGCACTGTACAG ACAGTGGATTTGGAGCCCGGTTGCTGGAGCTGTGTAACCAGGGCCTGTTTGAATGC

TTGGCCCTGAACCTCCACTGCTTGGGGGGACAGCAAATGGAGCTTGCTGCTGTCATCAATGGTCGAATT CGCCGCATGTCTCGCGGGGTGAATCCATCC

TTGGTGAGCTGGCTGACAACCATGATGGGACTGAGGCTTCAGGTGGTCTTGGAGCACATGCCTGTGGGTCCCGACGCCATCCTCAGATATGTTCGTAGGG

TTGGTGATCCTCCTCAG ACACTTCCTGAAGAGCCGATGGAAGTTCAGGGAGCAGAAAGAACTTCCCCTGAACCTCAG AGAGAGAATGCTTCCCCAGCC

CCTGGAACAACAGCAGAAGAAGCCATGTCCCGAGGCCCGCCCCCTGCTCCTGAAGGAGGTTCCCGAGATGAACAGGATGGAGCTTCAGCTGATGCAGAAC

CCTGGGCAGCTGCAGTCCCCCCT GAATGGGTCCCTATTATCCAGCAGGACATTCAGAGCCAGCGGAAGGTGAAACCTCAGCCGCCCCTGAGTGATGCCT

ACCTCAGTGGCATGCCTGCCAAGAGACGAAAG ACAATGCAGGGTGAGGGCCCCCAGCTGCTACTCTCAGAGGCAGTGAGCCGGGCAGCTAAGGCAGCCG

GAGCTCGGCCCCTGACAAGCCCCGAGAGCCTGAGCCGGGACCTGGAGGCACCAGAGGTTCAGGAGAGCTACAGGCAGCAG CTCCGGTCTGATATCCAAA

AACGACTGCAGGAAGATCCCAACTACAGCCCCCAGCGCTTCCCTAATGCCCATCGGGCATTTGCTGATGACCCCTAG
Translation
 - UNI20427 - MEPSDSASTAMEEPDSLEVLVKTLDSQTRTFIVGAQ - UNI26926 - MNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKL

QEYN - UNI25613 - NVGGKVIHLVERAPPQTQLPSGASSGTGSASATHGGAPLPGTRGPGASVHDRNANSYVMVGTFNLP SDGSAVDVHINMEQA

PIQ SEPRVRLVMAQHMIRDIQTLLSRME CRGGTQAQASQPPPQTPQTVASETVALNSQTSEPVESEAPPREPMESEEMEERPPTQTPELAPSGPAPAG

PAPAGPAPAPETNAPN NHPSPAEHVEVLQELQRLQRRLQPFLQRYCEVLGAAATTDYNNN HEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACA

PPRHLHVVRPMSHYTTPMVLQQAAIPIQ INVGTTVTMTGNGARPPPAPGAEAATPGSAQATSLPPSSTTVDSSTEGAPPPGPAPPPASSHPRVIRISHQ

SVEPVVMMHMNIQD DSGAQPGGVPSAPTGPLGPPGHGQTLG GSTLIQLPSLPPEFMHAVAHQITHQAMVAAVASAAAG GQQVPGFPTAPTRVVIARP

TPPQARPSHPGGPPVSGAL GAGLGTNTSLAQMVSGLVGQLLMQPVLVA AQGTPGMAQAQAQAQAQAQAQAQAPAPAPAPAPAPATASASAGTTNTATT

AGPAPGGPAQPPPPQPSAADLQFSQLLGNLLGPAGPGAGGPGMASPTITVAMPGVPAFLQGMTDFLQ ASQTAPPPPPPPPPPPPAPEQQSTPPPGSPSG

GTASPGGLGPESLPPEFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALG GFFGALLSLLCQNFSMVDVVMLLHGHFQPLQRL

QPQLRSFFHQHYLGGQEPTPSNIR MATHTLITGLEEYVRESF SLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTD DSGFGARLLELCNQGLFECL

ALNLHCLGGQQMELAAVINGRI RRMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQ TLPEEPMEVQGAERTSPEPQ RENASP

APGTTAEEAMSRGPPPAPEGGSRDEQDGASADAEPWAAAVPP EWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRR  
Transcript ENSMUST00000025250
Sequence
GGGTGGTCGGCTCCCTCCCATCTCGGCCGGCCCGGGCCCGTCTCGCCCCCCAGAAACTCACTGTTCGGGGCTGTGGACTTTCTCATCGTGCCCCACGAAA

GTAAATCGGGGGAGACTGGGGGAGCCGGAAGTACCGCCTCGAGATCCCCCCAAATACGATCGGGGAAACGGAAGTGGCCCTTGGTGCCAGGTTGGGGGAG

ACCGGAAGTGACG - UNI20427 - AGAGCTGTCGGCCATGGAGCCGAGTGATAGTGCCAGTACCGCTATGGAGGAGCCTGACAGCCTGGAGGTACTG

GTGAAGACCCTGGACTCTCAGACTCGGACTTTTATTGTGGGGGCCCAG - UNI26926 - ATGAATGTAAAGGAGTTTAAGGAACACATAGCTGCCTC

TGTCAGCATCCCTTCCGAGAAACAGCGGCTCATCTACCAGGGCCGGGTCCTACAAGACGACAAGAAGCTCCAGGAGTACA - UNI25613 - ACGTTG

GGGGAAAGGTTATTCACCTGGTGGAACGGGCTCCTCCTCAGACTCAGCTTCCTTCTGGAGCATCTTCTGGGACAGGCTCTGCCTCAGCAACTCATGGTGG

GGCACCCCTGCCTGGCACTCGGGGCCCTGGGGCTTCTGTTCATGACCGGAATGCCAACAGCTATGTCATGGTTGGAACCTTCAATCTTCCT AGTGACGG

CTCTGCTGTGGATGTTCACATCAACATGGAACAGGCCCCAATTCAG AGTGAGCCCCGGGTCCGGCTGGTGATGGCTCAGCACATGATTAGGGATATACA

GACCTTACTGTCCCGGATGGAG TGTCGAGGGGGAACCCAAGCTCAGGCCAGTCAGCCACCCCCGCAGACACCGCAGACTGTGGCCTCAGAGACGGTAGC

CTTGAACTCACAAACATCAGAACCAGTCGAAAGTGAAGCTCCTCCTCGAGAGCCCATGGAGTCAGAAGAAATGGAGGAACGTCCCCCAACCCAGACTCCA

GAGCTTGCGCCCTCAGGCCCAGCTCCCGCAGGCCCAGCTCCCGCAGGCCCAGCTCCCGCGCCAGAGACAAATGCACCCAA CCACCCTTCCCCCGCAGAG

CACGTGGAGGTGCTCCAGGAGCTTCAGCGCTTGCAGCGCCGTCTTCAGCCTTTCCTACAGCGCTACTGCGAGGTCCTGGGCGCTGCTGCCACCACAGACT

ACAACAACAAC CATGAGGGCCGTGAGGAGGACCAGAGGTTGATCAACTTGGTTGGGGAGAGCCTGCGGCTACTGGGCAACACTTTCGTGGCATTGTCTG

ATCTGCGCTGCAATCTAGCCTGTGCACCCCCACGGCACCTGCACGTGGTTCGGCCTATGTCTCACTACACGACTCCCATGGTGCTCCAGCAGGCAGCCAT

TCCCATTCAG ATCAATGTGGGGACTACTGTGACCATGACAGGCAATGGGGCTCGGCCTCCACCAGCTCCTGGTGCGGAGGCAGCAACCCCAGGTTCTGC

CCAGGCCACATCCCTGCCTCCCTCTTCCACCACTGTTGATTCATCAACTGAAGGAGCTCCCCCACCAGGGCCAGCACCGCCACCAGCCTCCAGCCACCCA

CGGGTCATCCGGATTTCCCACCAGAGTGTGGAGCCCGTGGTCATGATGCACATGAACATTCAAG ATTCTGGAGCACAGCCTGGTGGTGTGCCAAGTGCT

CCCACTGGTCCACTGGGACCTCCTGGTCATGGACAGACCCTGG GACAGCAGGTGCCCGGCTTCCCAACAGCACCAACTCGGGTGGTGATTGCCCGGCCA

ACTCCTCCACAGGCTCGGCCTTCCCATCCTGGGGGACCTCCAGTCTCTGGAGCTCTG CAGGGCGCTGGGCTGGGTACAAACACTTCATTGGCCCAGATG

GTGAGCGGCCTTGTGGGGCAACTTCTTATGCAGCCTGTTCTTGTGG CTCAGGGGACTCCAGGAATGGCTCAGGCTCAGGCCCAGGCCCAGGCTCAGGCC

CAGGCCCAGGCCCAGGCTCCAGCTCCGGCTCCGGCTCCAGCTCCAGCTCCTGCCACTGCTTCAGCTAGTGCTGGTACTACCAACACAGCTACCACAGCTG

GCCCTGCTCCTGGGGGTCCTGCCCAGCCTCCACCTCCTCAGCCCTCTGCAGCTGATCTTCAGTTCTCTCAGCTCCTGGGAAATCTGCTGGGGCCTGCAGG

GCCAGGGGCTGGGGGGCCAGGCATGGCTTCTCCCACCATCACTGTGGCAATGCCTGGTGTCCCTGCTTTTCTCCAGGGCATGACTGATTTTTTGCAG GC

ATCACAGACTGCCCCTCCACCCCCTCCACCTCCTCCACCCCCACCCCCTGCCCCAGAGCAGCAGAGCACACCCCCACCAGGGTCTCCTTCTGGTGGAACA

GCAAGCCCTGGAGGCTTAGGTCCTGAGAGCCTGCCACCAGAGTTTTTCACCTCAGTGGTGCAGGGCGTGTTGAGCTCCCTCCTGGGCTCCTTGGGGGCTC

GAGCTGGCAGCAGTGAGAGTATCGCTGCCTTCATCCAACGCCTCAGTGGATCCAGCAACATCTTTGAGCCTGGGGCTGATGGCGCCCTTG GATTCTTCG

GAGCTCTGCTCTCTCTCCTGTGCCAGAATTTCTCCATGGTGGATGTGGTGATGCTTCTCCATGGCCATTTCCAGCCACTGCAGCGGCTCCAGCCACAGCT

GCGATCTTTCTTCCACCAGCACTACCTGGGTGGCCAGGAGCCCACGCCTAGCAACATCCGG ATGGCGACCCACACACTGATCACTGGGCTGGAAGAGTA

TGTAAGGGAGAGTTTT TCTTTGGTACAGGTTCAGCCAGGTGTGGATATCATCCGGACAAATTTAGAATTTCTCCAAGAGCAGTTTAACAGCATTGCTGC

TCATGTGCTGCACTGTACAG ACAGTGGATTTGGAGCCCGGTTGCTGGAGCTGTGTAACCAGGGCCTGTTTGAATGCTTGGCCCTGAACCTCCACTGCTT

GGGGGGACAGCAAATGGAGCTTGCTGCTGTCATCAATGGTCGAATT CGCCGCATGTCTCGCGGGGTGAATCCATCCTTGGTGAGCTGGCTGACAACCAT

GATGGGACTGAGGCTTCAGGTGGTCTTGGAGCACATGCCTGTGGGTCCCGACGCCATCCTCAGATATGTTCGTAGGGTTGGTGATCCTCCTCAG ACACT

TCCTGAAGAGCCGATGGAAGTTCAGGGAGCAGAAAGAACTTCCCCTGAACCTCAG AGAGAGAATGCTTCCCCAGCCCCTGGAACAACAGCAGAAGAAGC

CATGTCCCGAGGCCCGCCCCCTGCTCCTGAAGGAGGTTCCCGAGATGAACAGGATGGAGCTTCAGCTGATGCAGAACCCTGGGCAGCTGCAGTCCCCCCT

 GAATGGGTCCCTATTATCCAGCAGGACATTCAGAGCCAGCGGAAGGTGAAACCTCAGCCGCCCCTGAGTGATGCCTACCTCAGTGGCATGCCTGCCAAG

AGACGAAAG ACAATGCAGGGTGAGGGCCCCCAGCTGCTACTCTCAGAGGCAGTGAGCCGGGCAGCTAAGGCAGCCGGAGCTCGGCCCCTGACAAGCCCC

GAGAGCCTGAGCCGGGACCTGGAGGCACCAGAGGTTCAGGAGAGCTACAGGCAGCAG CTCCGGTCTGATATCCAAAAACGACTGCAGGAAGATCCCAAC

TACAGCCCCCAGCGCTTCCCTAATGCCCATCGGGCATTTGCTGATGACCCCTAGCTTTCTCACCAGGGGACCACTTCCCCCCTTCCTTCACAGTATTTAA

GAAATAAAAGTCGGATTTTCCTG
Translation
 - UNI20427 - MEPSDSASTAMEEPDSLEVLVKTLDSQTRTFIVGAQ - UNI26926 - MNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKL

QEYN - UNI25613 - NVGGKVIHLVERAPPQTQLPSGASSGTGSASATHGGAPLPGTRGPGASVHDRNANSYVMVGTFNLP SDGSAVDVHINMEQA

PIQ SEPRVRLVMAQHMIRDIQTLLSRME CRGGTQAQASQPPPQTPQTVASETVALNSQTSEPVESEAPPREPMESEEMEERPPTQTPELAPSGPAPAG

PAPAGPAPAPETNAPN NHPSPAEHVEVLQELQRLQRRLQPFLQRYCEVLGAAATTDYNNN HEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACA

PPRHLHVVRPMSHYTTPMVLQQAAIPIQ INVGTTVTMTGNGARPPPAPGAEAATPGSAQATSLPPSSTTVDSSTEGAPPPGPAPPPASSHPRVIRISHQ

SVEPVVMMHMNIQD DSGAQPGGVPSAPTGPLGPPGHGQTLG GQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGAL QGAGLGTNTSLAQMVSGL

VGQLLMQPVLVA AQGTPGMAQAQAQAQAQAQAQAQAPAPAPAPAPAPATASASAGTTNTATTAGPAPGGPAQPPPPQPSAADLQFSQLLGNLLGPAGPG

AGGPGMASPTITVAMPGVPAFLQGMTDFLQ ASQTAPPPPPPPPPPPPAPEQQSTPPPGSPSGGTASPGGLGPESLPPEFFTSVVQGVLSSLLGSLGARA

GSSESIAAFIQRLSGSSNIFEPGADGALG GFFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPSNIR MATHTLITGLEE

YVRESF SLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTD DSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRI RRMSRGVNPSLVSW

LTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQ TLPEEPMEVQGAERTSPEPQ RENASPAPGTTAEEAMSRGPPPAPEGGSRDEQDGASADAEPWA

AAVPP EWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRK TMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQ LRSDIQK

RLQEDPNYSPQRFPNAHRAFADDP

For any suggestions or comments, please send an email to unitrap@crg.es