Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024436 (Mrps18b)
Chromosomal location
Chr 17: 36047331 - 36053334 (-)
Description
mitochondrial ribosomal protein S18B Gene [Source:MGI Symbol;Acc:MGI:1914223]
RefSeq_dna
NM_025878 
RefSeq_peptide
NP_080154.1 
UniGene
Mm.29484 
MGI
MGI:1914223 
Uniprot/SWISSPROT
Q99N84 
Uniprot/SPTREMBL
Q542W5 Q3THT9 Q3TKB7 
Human Ortholog
ENSG00000204568 (MRPS18B)
Omim not available
UniTrap UNI15265
Vector Insertion
Chr 17: 36051640 - 36053335
Public Clones (sanger) PST10404-NR (escells) IST11582H10 (tigm) IST14413D1 (tigm)
IST11840A9HMF1 (tigm) IST14620E1 (tigm) IST14282A3 (tigm) IST14405B2 (tigm)
Private Clones OST452252 (lexicon) OST437790 (lexicon) OST432179 (lexicon) OST432178 (lexicon)
OST426199 (lexicon) OST348783 (lexicon) OST321653 (lexicon) OST318305 (lexicon)
OST296383 (lexicon) OST283306 (lexicon) OST221810 (lexicon) OST208685 (lexicon)
OST94842 (lexicon) OST72865 (lexicon) OST44100 (lexicon) OST33206 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22504
Vector Insertion
Chr 17: 36051535 - 36051640
Public Clones PST22331-NR (escells)
Private Clones OST295042 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28150
Vector Insertion
Chr 17: 36049350 - 36051278
Public Clones not available
Private Clones OST38583 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29403
Vector Insertion
Chr 17: 36047902 - 36048363
Public Clones YHA116 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113782
Sequence
AGGCCGTACGTCCGGTGTGCGTCAAGATGGCTGCCCCCTTGCGGCACACGCTTCTAAAGCTGGTTCCTACACTCTTACGAAGTTCCTATGTAGCTCAG -

 UNI15265 - - UNI22504 - - UNI28150 - AATGTGAAGCTCTTGGAACAGTTTGTCTGTGCACACACGGGTATCATCTTTCACGCCCCATA

CACAG GGGTCTGTATGAAGCAGCACAAGAAGCTGACCCAGGCCATCCAGAAAGCCAGGGAGTGTG - UNI29403 - GTCTTCTCAGTTACTACGTC

CCCCAGGTTGAGCCCCGGGATGCTGACTTTGGTACTGTGCATGGAGCTGTCAGTGTGACTCCACCAGCCCCCACACTGTTGTCAGGTGAACCTTGGTACC

CATGGTACAGCTGGCAACAGCCACCAGAGAGAGAGCTGTCTCGCCTTCGCCGACTCTATCAAGGAAATCTCCTAGAAGAAAGTGGCCCGCCACCTGAGTC

GATGCCAGAGATGCCCACTACACCACCAGCAGAATCCTCCATTGAGCAGCCAGGCTCCCAGAGTGCTTAGAACTTGTGACCTGGGGAAGTCAGACCAAGG

GAGTACTGTCTAGGGCTACGTGGTATCCTGTGTCCTGCAAAGGGTTCTGTTTTGTGACAGTGGCAGACCCTATAGGGAACTGGCTGGCATGAAGAGAACA

AAGCACATTTGACGTTGAGGGGGACTAGATGTTTATGGGTAACTGGTGAGGACTTACATATAAACTGGAGACTCTTGTGTATGCCCTTGATGGTGTGTCC

CTGATTTAAACCTCCTGGCTCAGCTTTTATACAATAAAGCTGTGTCTCTTC
Translation
MAAPLRHTLLKLVPTLLRSSYVAQ - UNI15265 - - UNI22504 - - UNI28150 - NVKLLEQFVCAHTGIIFHAPYTG GVCMKQHKKLTQ

AIQKARECG - UNI29403 - GLLSYYVPQVEPRDADFGTVHGAVSVTPPAPTLLSGEPWYPWYSWQQPPERELSRLRRLYQGNLLEESGPPPESMPE

MPTTPPAESSIEQPGSQSA
Transcript ENSMUST00000025305
Sequence
AGGCCGTACGTCCGGTGTGCGTCAAGATGGCTGCCCCCTTGCGGCACACGCTTCTAAAGCTGGTTCCTACACTCTTACGAAGTTCCTATGTAGCTCAG -

 UNI15265 - GTTCCCCTCCAGACTCTTTGCACCAGAGGCCCTCCTGAAGAAGATGCTCCATCCTCGCTTCCCGTTTCCCCATATGAGAGCGAGCCTT

GGAAGTACCTGGATTCAGAAG - UNI15265 - - UNI22504 - AATACCACAACCGCTATGGCTCTCGCCCTGTTTGGGCTGACTACCGCCGCAA

CCACAAAGGTGGTGTGCCACCACAGCGGACCCGAAAGACATGTATT CGTAACAATAAAGTTGCTGGGAATCCTTGCCCAATCTGCCGGGATCACAAGTT

GCATGTTGACTTTAGG - UNI28150 - AATGTGAAGCTCTTGGAACAGTTTGTCTGTGCACACACGGGTATCATCTTTCACGCCCCATACACAG GG

GTCTGTATGAAGCAGCACAAGAAGCTGACCCAGGCCATCCAGAAAGCCAGGGAGTGTG - UNI29403 - GTCTTCTCAGTTACTACGTCCCCCAGGT

TGAGCCCCGGGATGCTGACTTTGGTACTGTGCATGGAGCTGTCAGTGTGACTCCACCAGCCCCCACACTGTTGTCAGGTGAACCTTGGTACCCATGGTAC

AGCTGGCAACAGCCACCAGAGAGAGAGCTGTCTCGCCTTCGCCGACTCTATCAAGGAAATCTCCTAGAAGAAAGTGGCCCGCCACCTGAGTCGATGCCAG

AGATGCCCACTACACCACCAGCAGAATCCTCCATTGAGCAGCCAGGCTCCCAGAGTGCTTAGAACTTGTGACCTGGGGAAGTCAGACCAAGGGAGTACTG

TCTAGGGCTACGTGGTATCCTGTGTCCTGCAAAGGGTTCTGTTTTGTGACAGTGGCAGACCCTATAGGGAACTGGCTGGCATGAAGAGAACAAAGCACAT

TTGACGTTGAGGGGGACTAGATGTTTATGGGTAACTGGTGAGGACTTACATATAAACTGGAGACTCTTGTGTATGCCCTTGATGGTGTGTCCCTGATTTA

AACCTCCTGGCTCAGCTTTTATACAATAAAGCTGTGTCTCTTC
Translation
MAAPLRHTLLKLVPTLLRSSYVAQ - UNI15265 - VPLQTLCTRGPPEEDAPSSLPVSPYESEPWKYLDSEE - UNI15265 - - UNI22504 

- EYHNRYGSRPVWADYRRNHKGGVPPQRTRKTCI RNNKVAGNPCPICRDHKLHVDFR - UNI28150 - NVKLLEQFVCAHTGIIFHAPYTG GVC

MKQHKKLTQAIQKARECG - UNI29403 - GLLSYYVPQVEPRDADFGTVHGAVSVTPPAPTLLSGEPWYPWYSWQQPPERELSRLRRLYQGNLLEES

GPPPESMPEMPTTPPAESSIEQPGSQSA

For any suggestions or comments, please send an email to unitrap@crg.es