Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024457 (Trim26)
Chromosomal location
Chr 17: 36974086 - 36996325 (+)
Description
tripartite motif-containing 26 Gene [Source:MGI Symbol;Acc:MGI:1337056]
RefSeq_dna
NM_001025599 
RefSeq_peptide
NP_001020770.2 
UniGene
Mm.34587 
MGI
MGI:1337056 
Uniprot/SWISSPROT
Q99PN3 
Uniprot/SPTREMBL
A2VDF6 Q8R0Q5 Q3TBW8 Q3UFX3 
Human Ortholog
ENSG00000137313 (TRIM26)
Omim not available
UniTrap UNI23296
Vector Insertion
Chr 17: 36974518 - 36987600
Public Clones (sanger) D151E12 (ggtc) CMHD-GT_536C9-3 (cmhd) CMHD-GT_536C9-5S (cmhd)
IST14813C1 (tigm) IST11554C2 (tigm) IST13056F7 (tigm) IST12551E1 (tigm)
IST15000H3 (tigm) IST14161F10 (tigm)
Private Clones OST266503 (lexicon) OST234894 (lexicon) OST167812 (lexicon) OST143799 (lexicon)
OST85334 (lexicon) OST77694 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24338
Vector Insertion
Chr 17: 36993717 - 36993933
Public Clones not available
Private Clones OST224422 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087160
Sequence
CATACCCCAGGTCGACGAGCGACCTCCAGGATGACCTTCCTCCCTGTTCCTATTGCCTCCTGCCACCATTCCCCAAGGAGCAGCCCG GACACCAAGGAC

TTCGCCAACAA GTACCCACGGAAGAAGTTCTGGATTGGGAAAGCCATCCCTCACATGGTTAAAAGAAAGGCAGGAGAATTCTCAGATAAACTTCTTTCT

CTGCAGCGAGGCCTGAGGCAGTTCCAGG - UNI24338 - GCAAGCTGCTGAGAGACTTGGAGTATAAGACAG TAAGCGTCACCCTGGACCCACAGT

CGGCCAGTGGATACCTACATCTTTCAGAGGACTGGAAGTGTGTGACCTATACTGGCCAATACCAGAGTGACTGTCTGCTCCCCCAGCAGTTTGACTGTGA

GCCAGGAGTGTTGGGCAGCAAGGGCTTCACATGGGGAAAGGTATACTGGGAAGTAGAGTTGGAGAGAGAAGGCTGGTCAGAGGATGAAGAAGAGGGGGAG

GAGGAAGAAGAAGGGGAAGAAGAGGAAGAAGACGAGGAGGTTGGCTATGGGGACGGATACGAAGACTGGGAAACAGATGAAGAAGACGAATCACTGGGGG

AAGAGGAAGAGGAGGAAGAGGAAGAAGAAGAAGAAGTTCAGGAAAGCTGCATGGTGGGAGTGGCCAAAGACTCTGTGAAGAGGAAAGGGGACCTCTCCCT

GCGACCAGAAGATGGTGTGTGGGCCCTTCGGCTCTCCCCCTCAGGTATCTGGGCCAACACGAGCCCAGAGGCCCAGCTGTTCCCGGTGCTGCGGCCCCGG

AGAGTGGGCATCGCCCTGGATTATGAAGGTGGCACTGTGACATTCACCAATGCAGAGTCCCAGGAACTCATCTATACCTTCACGACCACCTTCACCCGGC

GCCTGGTTCCCTTCCTGTGGCTCAAGTGGCCAGGAGCACGCCTTCTGCTGAGACCCTGAACTCCAGAACCCGCCTGGGTCACCCTACAGAAACTTTACTT

CTCTGAGAGTCCAGGACTCTGAGATGAAGAAAGATTACCTGGATCCCACACCCATGGAAACTTCCCTTCTCTGGGATCCCAAAACTATAATGGAGGAAGG

TTCCTGGCCAGAGCACTAGGAGGAGGAGAGAGAGGGACATCACATCCATTGCCACCCATCTCCCCACTGCCACGGCCAAAGTCTCTCAACACTGTCACCC

TATCCATATATCTTACTCAGCTTCTCATTTCCTCTGAGGTTTCCTGCTCTGAAGACCAAATGACTCCCTCTTTCCTGAACACACCCATTTGTCTTGTCCC

TGTGTTCTTTGTTGAGCAGGGCCTTGGCAGCAGCATTTTCTGGTTCAGTTGTTAGCCAGTGCCCACAGGTAGACTTTCCATCACATCTGAAGCTGTTTTT

GCTGTCCTCGAAGTTGAGGTACCCCGTGCCCAAAACCACTCTGTTGCCTACCTTTCCTGGTGTCTTAAATCACTTTTCCTTACCCCACAAGAGTTAAATA

TGCAAAGATGCAAGAATGGATGTAGTCATGACCCACAGAAGTTTCCAAGGCCGTGTAAGTTTGTGTCCTGGAGTGCTGGTAGAATCATCTCCTAGCGTGA

GTACCAAAGTTTCTAGCCTCAAACCCAGACCTGAGTAGGTAGGACTCCCCAGGGACATCTGTGTTTCAGAAAGCATCTAGGTACTATGACTCAGATAGTG

ACTGTGATCAATAAATTACCTCTGCAGAGCAGTCCTTGTGAAGGAAGTTTTTAAAACAACCCGAACATCTTGCTCTTGACCAGGAGGTCAAGACCTCGTT

GCTGACACTATGGAGTGTCCAGATTCACTTTCCTAGGAGATGGACTGGGGAAGGGGAGAGAGGGCCATGAGGAATCTAGAGAGCCTCTGTCCTAGGTCTT

ACTATGGAGAAAGGGCCTGCAGTATCGCCCTGCTGACCCAGCTGGTGCCCATAGTTGAACATGAGTCCCTGCTTAGCCAAAATGATGCCCCCCTTTTTAT

CCTTAAACATTCCAGATTTCTTCTGCCCGTGCAAGTGTTAGCTCCTCTTGGCTCTTGAACAGACTGTTCCCAGACACTGGATCTTGGTGGCCTCGGAGTC

ACCACAGCGTCTCGAGACTGAACACTTCGTATGCATCACATGCTGCCTGAGTCACTAGTACCTACACAGTGGCTCCCTCACCACTCTTTGTTCTAGAGTT

AATCATCTTCATTTCCTGTGTCTTTATTACTAAATAAACTACACATTTTTCTCAGTG
Translation
HTPGRRATSRMTFLPVPIASCHHSPRSSP DTKDFANK KYPRKKFWIGKAIPHMVKRKAGEFSDKLLSLQRGLRQFQG - UNI24338 - GKLLRDL

EYKTV VSVTLDPQSASGYLHLSEDWKCVTYTGQYQSDCLLPQQFDCEPGVLGSKGFTWGKVYWEVELEREGWSEDEEEGEEEEEGEEEEEDEEVGYGDG

YEDWETDEEDESLGEEEEEEEEEEEEVQESCMVGVAKDSVKRKGDLSLRPEDGVWALRLSPSGIWANTSPEAQLFPVLRPRRVGIALDYEGGTVTFTNAE

SQELIYTFTTTFTRRLVPFLWLKWPGARLLLRP
Transcript ENSMUST00000053434
Sequence
GCGGAGGGCCCGGAGCTCCCGGAGACTGCTGGGCGGGGAGACTGTGGTGCCGGCTGCTTGCTCAGGACCTACCCCGCGGAGCAGCTCCAGGGAGAGGAGT

GACCCGGCCCGGAGAGCGGCGCGG GTCCAACCCAGACTTACTTCAGTCTCTTCCAGTCCCCAGAGCCAGAAGTGAGCGGGACCCGGATGACGTTCCACC

TGGTGGCTTGGAGCCCTGCATGACCAGAAGCAG - UNI23296 - GTCTAAGGAACAGAGACCCCCAACCTAAGGGTGCAATGGCAGTGTCAGCCCCC

TTGAGGAGCCTGGAGGAAGAGGTGACCTGCTCCATCTGCCTGGATTACCTGAGGGACCCGGTGACCATCGACTGTGGCCATGTCTTCTGTCGCAGCTGCA

CAAGTGATATCCGCCCCATATCGGGGAACCGGCCTGTCTGCCCGCTCTGCAAGAAGCCCTTTAAGAAGGAGAACATCCGACCCGTGTGGCAGCTAGCAAG

TCTGGTGGAGAACATTGAACGGCTGAAGGTGGACAATGGCAGACAGCCAGGAGAGCTCGCCCGCGAGCCACAGGACATGAAGTTGTGTGAGCGGCACCAG

GAGAAGCTACACTACTACTGTGAAGATGATGGCAAACTGTTGTGTGTGATGTGCAGGGAGTCCCGGGAGCACCGCCCCCACACTGCAGTCCTGGTGGAGA

AAGCCGCCCTGCCTCACAGA GAGAAAATTCTGAACCACTTGAACACCCTAAGGAGAGACAGAGACAAAATCCAGGGCTTTCAAGCCAAGGGAGAAGCTG

ATATTCTGGCTGCACTG ACAAAGCTGCAGGAGCAGAGGCAGTACATTGTGGCGGAATTTAAGCAGGGCCACCAGTTTCTAAAGAAGCGGGAGCAGCACC

TGCTAGACCAGCTGGCCACCTTGGAGCAGCTCCTCACCGAGGGCAGGGAGAAGTTCAAGACCCGGGGCGTCAGTGAGCTTGACCGGTTGACTCTGGTCAT

CTCCGAGCTGGAGGGCAAGGCACGACAGCCAGCTGCAGAGCTGATGCAG GATGTCTGCACTACACAG GACACCAAGGACTTCGCCAACAA GTACCCA

CGGAAGAAGTTCTGGATTGGGAAAGCCATCCCTCACATGGTTAAAAGAAAGGCAGGAGAATTCTCAGATAAACTTCTTTCTCTGCAGCGAGGCCTGAGGC

AGTTCCAGG - UNI24338 - GCAAGCTGCTGAGAGACTTGGAGTATAAGACAG TAAGCGTCACCCTGGACCCACAGTCGGCCAGTGGATACCTACA

TCTTTCAGAGGACTGGAAGTGTGTGACCTATACTGGCCAATACCAGAGTGACTGTCTGCTCCCCCAGCAGTTTGACTGTGAGCCAGGAGTGTTGGGCAGC

AAGGGCTTCACATGGGGAAAGGTATACTGGGAAGTAGAGTTGGAGAGAGAAGGCTGGTCAGAGGATGAAGAAGAGGGGGAGGAGGAAGAAGAAGGGGAAG

AAGAGGAAGAAGACGAGGAGGTTGGCTATGGGGACGGATACGAAGACTGGGAAACAGATGAAGAAGACGAATCACTGGGGGAAGAGGAAGAGGAGGAAGA

GGAAGAAGAAGAAGAAGTTCAGGAAAGCTGCATGGTGGGAGTGGCCAAAGACTCTGTGAAGAGGAAAGGGGACCTCTCCCTGCGACCAGAAGATGGTGTG

TGGGCCCTTCGGCTCTCCCCCTCAGGTATCTGGGCCAACACGAGCCCAGAGGCCCAGCTGTTCCCGGTGCTGCGGCCCCGGAGAGTGGGCATCGCCCTGG

ATTATGAAGGTGGCACTGTGACATTCACCAATGCAGAGTCCCAGGAACTCATCTATACCTTCACGACCACCTTCACCCGGCGCCTGGTTCCCTTCCTGTG

GCTCAAGTGGCCAGGAGCACGCCTTCTGCTGAGACCCTGAACTCCAGAACCCGCCTGGGTCACCCTACAGAAACTTTACTTCTCTGAGAGTCCAGGACTC

TGAGATGAAGAAAGATTACCTGGATCCCACACCCATGGAAACTTCCCTTCTCTGGGATCCCAAAACTATAATGGAGGAAGGTTCCTGGCCAGAGCACTAG

GAGGAGGAGAGAGAGGGACATCACATCCATTGCCACCCATCTCCCCACTGCCACGGCCAAAGTCTCTCAACACTGTCACCCTATCCATATATCTTACTCA

GCTTCTCATTTCCTCTGAGGTTTCCTGCTCTGAAGACCAAATGACTCCCTCTTTCCTGAACACACCCATTTGTCTTGTCCCTGTGTTCTTTGTTGAGCAG

GGCCTTGGCAGCAGCATTTTCTGGTTCAGTTGTTAGCCAGTGCCCACAGGTAGACTTTCCATCACATCTGAAGCTGTTTTTGCTGTCCTCGAAGTTGAGG

TACCCCGTGCCCAAAACCACTCTGTTGCCTACCTTTCCTGGTGTCTTAAATCACTTTTCCTTACCCCACAAGAGTTAAATATGCAAAGATGCAAGAATGG

ATGTAGTCATGACCCACAGAAGTTTCCAAGGCCGTGTAAGTTTGTGTCCTGGAGTGCTGGTAGAATCATCTCCTAGCGTGAGTACCAAAGTTTCTAGCCT

CAAACCCAGACCTGAGTAGGTAGGACTCCCCAGGGACATCTGTGTTTCAGAAAGCATCTAGGTACTATGACTCAGATAGTGACTGTGATCAATAAATTAC

CTCTGCAGAGCAGTCCTTGTGAAGGAAGTTTTTAAAACAACCCGAACATCTTGCTCTTGACCAGGAGGTCAAGACCTCGTTGCTGACACTATGGAGTGTC

CAGATTCACTTTCCTAGGAGATGGACTGGGGAAGGGGAGAGAGGGCCATGAGGAATCTAGAGAGCCTCTGTCCTAGGTCTTACTATGGAGAAAGGGCCTG

CAGTATCGCCCTGCTGACCCAGCTGGTGCCCATAGTTGAACATGAGTCCCTGCTTAGCCAAAATGATGCCCCCCTTTTTATCCTTAAACATTCCAGATTT

CTTCTGCCCGTGCAAGTGTTAGCTCCTCTTGGCTCTTGAACAGACTGTTCCCAGACACTGGATCTTGGTGGCCTCGGAGTCACCACAGCGTCTCGAGACT

GAACACTTCGTATGCATCACATGCTGCCTGAGTCACTAGTACCTACACAGTGGCTCCCTCACCACTCTTTGTTCTAGAGTTAATCATCTTCATTTCCTGT

GTCTTTATTACTAAATAAACTACACATTTTTCTCAGTG
Translation
  - UNI23296 - MAVSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTSDIRPISGNRPVCPLCKKPFKKENIRPVWQLASLVENIERLKVDN

GRQPGELAREPQDMKLCERHQEKLHYYCEDDGKLLCVMCRESREHRPHTAVLVEKAALPHR EKILNHLNTLRRDRDKIQGFQAKGEADILAAL TKLQE

QRQYIVAEFKQGHQFLKKREQHLLDQLATLEQLLTEGREKFKTRGVSELDRLTLVISELEGKARQPAAELMQ DVCTTQ DTKDFANK KYPRKKFWIGK

AIPHMVKRKAGEFSDKLLSLQRGLRQFQG - UNI24338 - GKLLRDLEYKTV VSVTLDPQSASGYLHLSEDWKCVTYTGQYQSDCLLPQQFDCEPG

VLGSKGFTWGKVYWEVELEREGWSEDEEEGEEEEEGEEEEEDEEVGYGDGYEDWETDEEDESLGEEEEEEEEEEEEVQESCMVGVAKDSVKRKGDLSLRP

EDGVWALRLSPSGIWANTSPEAQLFPVLRPRRVGIALDYEGGTVTFTNAESQELIYTFTTTFTRRLVPFLWLKWPGARLLLRP

For any suggestions or comments, please send an email to unitrap@crg.es