Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024459 (D130003B22Rik)
Chromosomal location
Chr 17: 37121006 - 37126449 (-)
Description
histocompatibility 2, M region locus 6, pseudogene Pseudogene [Source:MGI Symbol;Acc:MGI:95918]
RefSeq_peptide
NP_001108547.1 
MGI
MGI:3036265 MGI:95918 
Uniprot/SPTREMBL
A2CFG8 A7VMS3 Q08EG4 
Human Ortholog
not available
Omim not available
UniTrap UNI28339
Vector Insertion
Chr 17: 37126150 - 37126373
Public Clones (sanger) IST11822G4 (tigm) IST11759G3 (tigm) IST10173G11 (tigm)
Private Clones OST33507 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9935
Vector Insertion
Chr 17: 37124876 - 37125449
Public Clones (sanger) XC230 (baygenomics) IST12422E6 (tigm) IST11715E12HMF1 (tigm)
IST12329G12 (tigm) IST13065C6 (tigm) IST11816G7 (tigm) IST12516E1 (tigm)
Private Clones OST322889 (lexicon) OST299197 (lexicon) OST276675 (lexicon) OST267960 (lexicon)
OST216004 (lexicon) OST65250 (lexicon)
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5839
Vector Insertion
Chr 17: 37124469 - 37124599
Public Clones CSH934 (baygenomics) M064B08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30976
Vector Insertion
Chr 17: 37121005 - 37124469
Public Clones 5SE086G01 (ggtc) IST12315D12 (tigm) IST11006A12 (tigm) IST10385A6 (tigm)
IST14949H5 (tigm) IST12536C5 (tigm) IST12355A8 (tigm) IST10049E1 (tigm)
IST11566B5 (tigm) IST11975H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113667
Sequence
ATGAGAAGCCCTGCGCTCTCTACCCTCCTATCCTTGCTGCTCACCGGAGCTTTGGCCTTGACCCTGGTTCGCGCAG - UNI28339 - GCATCCATTC

CTTGCAGTTTTTTGCCACCACCATGACCCAGCCTGGTTTGAGGGAGCATTCCTTCATCTTTGTCGTCTTCGTGGACGACACACAGTTCCTGTGCTACAAC

AATAAGGGGAAAAATCAGAGAATGGAGCCACGCGCTCTGTGGGTGAAGCAGATGGGGCCAGAGTATTGGGAACAGCAGACCAGGACTGTCAAGGTCATTG

AGAAGATTGCCCTAGTGAATTTGCAGGAGGCCATGGACATCTACAACCACAGCAAGGATG GCTCTCACGTCTTTCAGTGTGTGTATGGCTGCGAAGTGG

GGCCAGATGGACTCTTCCTCCGTGGGCATGAGAAGCACGCATACGACGGCCGCGATTACCTCACCCTAAGCCCGGACCTGCACTCCTGGGTCGCAGGCGA

CACAGCTGCGCAGATCACGCTGCGCAGGTGGGAGAAGTCTGGTGTCTCTGAGCAAAGGCAATCCTTCTTGAAGGGCGAGTGTGTGGAGTCGCTCCGCACA

TACCTGGAGATAGGGAAGGAGACTCTGCTAAGAACAG - UNI9935 - ATCCTCCCAAGGCACATGTGACCCATCACCCCAGACCTGAAGGTGAAGTC

ACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCTAACATCATCCTGACCTGGCAGTGGGATGAGGAAGACCTGACTCAGGACATGGACCTCATTGAGA

CCAGACCTGCAGGGGATGGGACCTTCCAGAAGTGGGCATCTGTGGTGGTACCTTCTGGAGAGGAACAGAGATACACATGTCATGTGCAACATGAGGGGCT

AACCCAGCCCCTTGTTCTAAAATGGG - UNI5839 - - UNI30976 - ACCCTTCTAAGCACACCATTCCCATCATGGGAATCACTGTTGGCCTGC

TTCTCTTTGGAGTTGTGTTTACTGGAGCTGTGGTTGCCATAGTGATGAGGAAGAGGAAAG - UNI30976 - GGTCTCACACTGTACCCTAGACTGGG

CTGGAACTCACTGTGTAGCTGTGAATGCTAATCTTCATTGTCAGATTGACTGGATCTCAAATCTCACAGGAAATGTCTGTGAAGGTGTTTTCCAGAGACT

AACCAAAGGAGGGGAGAGCTGCACTGTGGGGGGAGCTGCACTGAATGATTTGGGGGCCCAGATTGAAGACATGGGAGGGAGAGGAGGAAGCCAGATGAGG

GGCAGCATCCCCACACTCTGCCCCACACTTTGGAACTGGAATTGCTTGTGAGCCACAGCCTGGGTGGTGAGAATCAAACCAAGATGCTCTTAACCTGGGC

CAACTTTCTAGCCCCTGCATTTACATTTCTATAAGCCCGCTTCAAAAGCATCATGAAATGCTACTGTAACCTCCTCAATATCTGCATCTATTCTGTGACC

CTCATCTATACATATATTTACAGTGTGATATGTCATATTTGAGAGAATATTAGTAATTAAGATTGGAATAAATGGATATGGGTTTGCTTCAATTAGATTA

CCAAGGAAAGCAATATTACCTGCCAAATTCTCACCATGGAAACTGAATTCACTTATTGAATTTATTGTAATTCAATTGTGACATTTTGGAAACATACAAG

CTTGATCATTTTTCTTTCTGTTTGTGCTGTTTGGTTTGGTTTTTTGAAACACTGTTTCTCGGTGTAGCCCTGGCTGTCGTGGAACTCACTCAGTAGGTCA

GGCTGGCATGTACCACTATTGCCCAGCCTCATCTATGTTTCTTTGGTTGAGAAAGAGTATCATGTAACCCAGGCTGGCCTCAAACTCATGGCAAACCTCC

TTTCTTAGCCTAACCTCCCACATGCTTGTTCTTCAGTGATGAGCTAAATTTTAAGTATATTTTTAAAATATTACATTAATTCTGAAAAAATTTTTATGTG

GATGTGGGGAGAAGATCAAGTTGTGTGATTCTGATCGAAGGTTCCGTCAGGAAAACAGTTTTAATGTGCATTCCATAGACCCAGACAAACTCTTTCTCAT

AAAGAAATCAAACAGT
Translation
MRSPALSTLLSLLLTGALALTLVRAG - UNI28339 - GIHSLQFFATTMTQPGLREHSFIFVVFVDDTQFLCYNNKGKNQRMEPRALWVKQMGPEYW

EQQTRTVKVIEKIALVNLQEAMDIYNHSKDG GSHVFQCVYGCEVGPDGLFLRGHEKHAYDGRDYLTLSPDLHSWVAGDTAAQITLRRWEKSGVSEQRQS

FLKGECVESLRTYLEIGKETLLRTD - UNI9935 - DPPKAHVTHHPRPEGEVTLRCWALGFYPANIILTWQWDEEDLTQDMDLIETRPAGDGTFQKW

ASVVVPSGEEQRYTCHVQHEGLTQPLVLKWD - UNI5839 - - UNI30976 - DPSKHTIPIMGITVGLLLFGVVFTGAVVAIVMRKRKG - UNI

30976 - GSHTVP

For any suggestions or comments, please send an email to unitrap@crg.es