Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024462 (Gabbr1)
Chromosomal location
Chr 17: 37183016 - 37210377 (+)
Description
gamma-aminobutyric acid (GABA-B) receptor, 1 Gene [Source:MGI Symbol;Acc:MGI:1860139]
RefSeq_dna
NM_019439 
RefSeq_peptide
NP_062312.3 
UniGene
Mm.32191 
MGI
MGI:1860139 
Uniprot/SWISSPROT
Q9WV18 
Uniprot/SPTREMBL
Q6PGJ2 Q8CAF8 
Human Ortholog
ENSG00000204681 (GABBR1)
Omim not available
UniTrap UNI20798
Vector Insertion
Chr 17: 37183235 - 37183639
Public Clones not available
Private Clones OST351937 (lexicon) OST102170 (lexicon) OST78459 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34236
Vector Insertion
Chr 17: 37183722 - 37184398
Public Clones IST11302A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11808
Vector Insertion
Chr 17: 37184603 - 37185365
Public Clones G002B07 (ggtc) (ggtc) E325B02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36563
Vector Insertion
Chr 17: 37186743 - 37187943
Public Clones IST14877E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11741
Vector Insertion
Chr 17: 37192893 - 37193240
Public Clones G072B05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36812
Vector Insertion
Chr 17: 37193925 - 37199478
Public Clones IST12264C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34640
Vector Insertion
Chr 17: 37199722 - 37200274
Public Clones IST11968G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10264
Vector Insertion
Chr 17: 37201683 - 37204158
Public Clones KST229 (baygenomics) G056G01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32489
Vector Insertion
Chr 17: 37207727 - 37208797
Public Clones IST11737G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113650
Sequence
CCCCTGAGCTGCCCCCACCCCAAGGAGGCCGCCCCCGCCCCTCCTCGCCATGGGCCCGGGGGGACCCTGTACCCCGGTGGGGTGGCCGCTGCCTCTTCTG

CTGGTGATGGCGGCTGGGGTGGCTCCGGTGTGGGCCTCTCACTCCCCTCATCTCCCGCGGCCTCACCCGAGGGTCCCCCCGCACCCCTCCTCAGAACGGC

GTGCAGTATACATCGGGGCGCTGTTTCCCATGAGCGGGGGCTGGCCGGGGGGCCAGGCCTGCCAGCCTGCGGTGGAGATGGCGCTGGAGGACGTTAACAG

CCGCAGAGACATCCTGCCGGACTACGAGCTCAAGCTTATCCACCACGACAGCAAG TGCGACCCAGGGCAAGCCACCAAGTACTTGTATGAACTACTCTA

CAACGACCCCATCAAGATCATCCTCATGCCCGGCTGCAGCTCTGTGTCCACACTGGTAGCCGAGGCTGCCCGGATGTGGAACCTTATTGTG CTCTCATA

TGGCTCCAGCTCACCAGCCTTGTCAAACCGACAGCGGTTTCCAACGTTCTTTCGGACACATCCATCCGCCACACTCCACAATCCCACCCGGGTGAAACTC

TTCGAAAAGTGGGGCTGGAAGAAGATTGCCACCATCCAGCAGACTACCGAGGTCTTCACCTCA ACACTGGATGACCTGGAGGAGCGAGTGAAAGAGGCT

GGGATTGAGATCACTTTTCGACAGAGTTTCTTCTCAGATCCAGCTGTGCCTGTTAAAAACCTGAAG - UNI11741 - CGTCAAGATGCTCGAATCAT

CGTGGGACTTTTCTATGAGACCGAAGCCCGGAAAGTTTTTTGTGAG GTCTATAAGGAACGGCTCTTTGGGAAGAAGTATGTCTGGTTTCTCATCGGGTG

GTATGCTGACAACTGGTTCAAAACCTATGACCCGTCAATCAATTGTACAGTAGAAGAGATGACTGAGGCGGTGGAGGGCCATATCACCACGGAGATTGTC

ATGCTGAACCCTGCCAACACCCGAAGCATTTCCAACATG - UNI36812 - ACATCACAGGAATTTGTGGAGAAACTAACCAAGCGGCTGAAAAGACA

CCCTGAGGAGACTGGAGGCTTCCAGGAGGCACCACTGGCCTATGATGCTATCTGGGCCTTGGCTTTGGCCTTGAACAAGACCTCTGGAGGAGGTGGCCGT

TCAGGAGTGCGCCTGGAGGACTTTAACTACAACAACCAGACCATTACAGACCAAATCTACCGGGCCATGAACTCCTCCTCCTTTGAGGGTGTTTCT - U

NI34640 - GGCCACGTGGTCTTTGATGCCAGCGGCTCCCGGATGGCATGGACGCTTATCGAGCAGCTACAGG GCGGCAGCTACAAGAAGATCGGCTA

CTACGACAGCACCAAGGATGATCTTTCCTGGTCCAAAACAGACAAGTGGATCG - UNI10264 - GAGGGTCTCCCCCAGCCGACCAGACCTTGGTCA

TCAAGACATTCCGTTTCCTGTCACAGAAACTCTTTATCTCCGTCTCAGTTCTCTCCAGCCTGGGCATTGTTCTTGCTGTTGTCTGTCTGTCCTTTAACAT

CTACAACTCCCACGTTCG TTATATCCAGAACTCCCAGCCCAACCTGAACAATCTGACTGCTGTGGGCTGCTCACTGGCACTAGCTGCTGTCTTCCCCCT

TGGGCTGGATGGTTACCACATAGGGAGAAGCCAGTTCCCATTTGTCTGCCAG GCCCGCCTTTGGCTCTTGGGCTTAGGCTTTAGTCTGGGCTATGGCTC

TATGTTCACCAAGATCTGGTGGGTCCACACAGTCTTCACAAAGAAGGAGGAGAAGAAGGAATGGAGGAAG ACCCTAGAGCCTTGGAAACTGTACGCCAC

TGTAGGCCTGCTGGTGGGCATGGATATCCTGACTCTTGCCATCTGGCAGATTGTGGACCCCTTGCACCGAACCATTGAG ACTTTTGCCAAGGAGGAACC

AAAGGAAGACATTGATGTCTCCATTCTGCCCCAGCTGGAGCACTGCAGCTCCAAGAAGATGAATACATGGCTCG GAGAGCTTTGGTCTTTTTGCTGTGA

GTAG
Translation
MGPGGPCTPVGWPLPLLLVMAAGVAPVWASHSPHLPRPHPRVPPHPSSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHD

SK CDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIV LSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQT

TEVFTS TLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLK - UNI11741 - RQDARIIVGLFYETEARKVFCE VYKERLFGKKYVWFLIGWYADN

WFKTYDPSINCTVEEMTEAVEGHITTEIVMLNPANTRSISNM - UNI36812 - TSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTS

GGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVS - UNI34640 - GHVVFDASGSRMAWTLIEQLQG GGSYKKIGYYDSTKDDLSWSKTDKWI

G - UNI10264 - GGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVR RYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGY

HIGRSQFPFVCQ ARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRK TLEPWKLYATVGLLVGMDILTLAIWQIVDPLHRTIE TFAKEEPKED

IDVSILPQLEHCSSKKMNTWLG GELWSFCCE
Transcript ENSMUST00000025338
Sequence
CTCGCGGCCGCCGTCGCCCCGGGGAAGGAGAGACGGGGGTGGGGTTTGCGGGTAGCGATCGCGAAGGGGAGAGACCCCGGCCGGGCTGGAGCCTGGATTC

CTGTGGAAGAAGAACAGGGGGAGGGGAAGCTGGAGGACCGGGAGGGAGAACGGGGAGCCGCGGCCGGGCCTGGGCCCTTGAGGCCCGGGGAGAGCCGCGG

AGCGGGACCGGCCGCCGAG - UNI20798 - ATGCTGCTGCTGCTGCTGGTGCCTCTCTTCCTCCGCCCCCTGGGCGCTGGCGGGGCTCAGACCCCCA

ACGTCACCTCGGAAG - UNI34236 - GTTGCCAGATTATACATCCGCCCTGGGAAGGTGGCATCAGGTACCGTGGCTTGACTCGCGACCAGGTGAAG

GCCATCAATTTCCTGCCTGTGGACTATGAGATTGAATATGTGTGCCGGGGCGAACGCGAGGTGGTGGGGCCCAAGGTGCGCAAGTGCCTGGCCAACGGCT

CCTGGACGGATATGGACACACCCAGTCGCTGTG - UNI11808 - TCCGAATCTGCTCCAAGTCTTATTTGACCCTGGAAAATGGGAAGGTTTTCCTG

ACGGGTGGGGACCTCCCAGCTCTGGATGGAGCCCGGGTGGATTTCCGATGTGACCCCGACTTCCATCTGGTGGGCAGCTCCCGGAGCATCTGTAGTCAGG

GCCAGTGGAGCACCCCCAAGCCCCACTGCCAGG TGAATCGAACGCCACACTCAG - UNI36563 - AACGGCGTGCAGTATACATCGGGGCGCTGTT

TCCCATGAGCGGGGGCTGGCCGGGGGGCCAGGCCTGCCAGCCTGCGGTGGAGATGGCGCTGGAGGACGTTAACAGCCGCAGAGACATCCTGCCGGACTAC

GAGCTCAAGCTTATCCACCACGACAGCAAG TGCGACCCAGGGCAAGCCACCAAGTACTTGTATGAACTACTCTACAACGACCCCATCAAGATCATCCTC

ATGCCCGGCTGCAGCTCTGTGTCCACACTGGTAGCCGAGGCTGCCCGGATGTGGAACCTTATTGTG CTCTCATATGGCTCCAGCTCACCAGCCTTGTCA

AACCGACAGCGGTTTCCAACGTTCTTTCGGACACATCCATCCGCCACACTCCACAATCCCACCCGGGTGAAACTCTTCGAAAAGTGGGGCTGGAAGAAGA

TTGCCACCATCCAGCAGACTACCGAGGTCTTCACCTCA ACACTGGATGACCTGGAGGAGCGAGTGAAAGAGGCTGGGATTGAGATCACTTTTCGACAGA

GTTTCTTCTCAGATCCAGCTGTGCCTGTTAAAAACCTGAAG - UNI11741 - CGTCAAGATGCTCGAATCATCGTGGGACTTTTCTATGAGACCGAA

GCCCGGAAAGTTTTTTGTGAG GTCTATAAGGAACGGCTCTTTGGGAAGAAGTATGTCTGGTTTCTCATCGGGTGGTATGCTGACAACTGGTTCAAAACC

TATGACCCGTCAATCAATTGTACAGTAGAAGAGATGACTGAGGCGGTGGAGGGCCATATCACCACGGAGATTGTCATGCTGAACCCTGCCAACACCCGAA

GCATTTCCAACATG - UNI36812 - ACATCACAGGAATTTGTGGAGAAACTAACCAAGCGGCTGAAAAGACACCCTGAGGAGACTGGAGGCTTCCAG

GAGGCACCACTGGCCTATGATGCTATCTGGGCCTTGGCTTTGGCCTTGAACAAGACCTCTGGAGGAGGTGGCCGTTCAGGAGTGCGCCTGGAGGACTTTA

ACTACAACAACCAGACCATTACAGACCAAATCTACCGGGCCATGAACTCCTCCTCCTTTGAGGGTGTTTCT - UNI34640 - GGCCACGTGGTCTTT

GATGCCAGCGGCTCCCGGATGGCATGGACGCTTATCGAGCAGCTACAGG GCGGCAGCTACAAGAAGATCGGCTACTACGACAGCACCAAGGATGATCTT

TCCTGGTCCAAAACAGACAAGTGGATCG - UNI10264 - GAGGGTCTCCCCCAGCCGACCAGACCTTGGTCATCAAGACATTCCGTTTCCTGTCACA

GAAACTCTTTATCTCCGTCTCAGTTCTCTCCAGCCTGGGCATTGTTCTTGCTGTTGTCTGTCTGTCCTTTAACATCTACAACTCCCACGTTCG TTATAT

CCAGAACTCCCAGCCCAACCTGAACAATCTGACTGCTGTGGGCTGCTCACTGGCACTAGCTGCTGTCTTCCCCCTTGGGCTGGATGGTTACCACATAGGG

AGAAGCCAGTTCCCATTTGTCTGCCAG GCCCGCCTTTGGCTCTTGGGCTTAGGCTTTAGTCTGGGCTATGGCTCTATGTTCACCAAGATCTGGTGGGTC

CACACAGTCTTCACAAAGAAGGAGGAGAAGAAGGAATGGAGGAAG ACCCTAGAGCCTTGGAAACTGTACGCCACTGTAGGCCTGCTGGTGGGCATGGAT

ATCCTGACTCTTGCCATCTGGCAGATTGTGGACCCCTTGCACCGAACCATTGAG ACTTTTGCCAAGGAGGAACCAAAGGAAGACATTGATGTCTCCATT

CTGCCCCAGCTGGAGCACTGCAGCTCCAAGAAGATGAATACATGGCTCG GCATTTTCTATGGTTACAAAGGGCTGCTGCTGCTGCTGGGAATCTTTCTT

GCTTATGAGACCAAAAGTGTGTCCACTGAAAAGATCAATGACCACAGGGCCGTGGGCATGGCTATCTACAATGTTGCG - UNI32489 - GTCCTGTG

TCTCATTACCGCTCCTGTCACCATGATCCTTTCCAGCCAGCAGGACGCAGCCTTCGCCTTTGCCTCTCTGGCCATTGTGTTCTCTTCCTACATTACTCTG

GTTGTGCTCTTTGTGCCTAAG ATGCGCAGGTTGATCACTCGAGGTGAATGGCAGTCTGAAGCACAGGACACAATGAAAACAGGATCATCCACCAACAAC

AATGAGGAAGAGAAGTCCCGACTGTTGGAGAAGGAAAACCGTGAATTGGAAAAGATCATCGCCGAG AAAGAGGAGCGTGTCTCTGAACTGCGCCATCAG

CTCCAGTCTCGGCAGCAGATCCGCTCCCGGCGCCACCCCCCAACACCCCCAGACCCCTCTGGGGGCCTTCCCAGGGGACCCTCAGAGCCCCCTGACCGGC

TTAGCTGTGATGGGAGTCGAGTACATTTGCTTTACAAGTGAGGGTGTATCGAGAAGGATGAGGCCAGCAGGGGAGGGAAGGGTGTGGGGAGTGGGTGGGG

AACTGGGAAGAGGGTGGAGAACAAGCTCCAATCCCCCTCTTAGAAATACATGTCATTCTGTGCATCTGGGGTTATCTGGGTCTTCAGTACTCTGGGAAAC

AGATGGTTTTCTTTCTTTCCATATAATTTTATATCACCACTTCACAGTTTTGTTTGAACCCTGCTTGGAGCTATTCACTCATGACTCCAGAGGGGCATCT

CGTTTGTCTCCCATAGGCTGTCTTGTATAGTTGTTACTACAGCAACTCCTGTCATTTCAGCAGCAGGGGTCTTCCTACATTATCAGGGCTTTCTCTCCAT

TTCTCAGCATTAGAATCTCCTTCCATCATCCTTCTCCTCCATGTCCC
Translation
 - UNI20798 - MLLLLLVPLFLRPLGAGGAQTPNVTSEG - UNI34236 - GCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEYVCRGERE

VVGPKVRKCLANGSWTDMDTPSRCV - UNI11808 - VRICSKSYLTLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHC

QV VNRTPHSE - UNI36563 - ERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSK CDPGQATKYLYELLYNDPIK

IILMPGCSSVSTLVAEAARMWNLIV LSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTS TLDDLEERVKEAGIEI

TFRQSFFSDPAVPVKNLK - UNI11741 - RQDARIIVGLFYETEARKVFCE VYKERLFGKKYVWFLIGWYADNWFKTYDPSINCTVEEMTEAVEGH

ITTEIVMLNPANTRSISNM - UNI36812 - TSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQ

IYRAMNSSSFEGVS - UNI34640 - GHVVFDASGSRMAWTLIEQLQG GGSYKKIGYYDSTKDDLSWSKTDKWIG - UNI10264 - GGSPPADQ

TLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVR RYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRSQFPFVCQ ARLWLLGLGF

SLGYGSMFTKIWWVHTVFTKKEEKKEWRK TLEPWKLYATVGLLVGMDILTLAIWQIVDPLHRTIE TFAKEEPKEDIDVSILPQLEHCSSKKMNTWLG 

GIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVA - UNI32489 - VLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPK

 MRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAE KEERVSELRHQLQSRQQIRSRRHPPTPPDPSGGLPRGPSEPPDRLSCDGS

RVHLLYK

For any suggestions or comments, please send an email to unitrap@crg.es