Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024533 (Spire1)
Chromosomal location
Chr 18: 67647863 - 67770443 (-)
Description
spire homolog 1 (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:1915416]
RefSeq_dna
NM_176832 NM_194355 
RefSeq_peptide
NP_789802.1 NP_919336.1 
UniGene
Mm.400948 Mm.208723 
MGI
MGI:1915416 
Uniprot/SWISSPROT
Q52KF3 
Uniprot/SPTREMBL
Q6ZPX2 
Human Ortholog
ENSG00000134278 (SPIRE1)
Omim not available
UniTrap UNI18721
Vector Insertion
Chr 18: 67690139 - 67705268
Public Clones not available
Private Clones OST416113 (lexicon)
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31419
Vector Insertion
Chr 18: 67672494 - 67679075
Public Clones IST12504E8 (tigm) IST12723G12 (tigm) IST13489C5 (tigm) IST11814B7 (tigm)
IST13296H12 (tigm) IST14092E6 (tigm) IST11628G7 (tigm) IST12869B3 (tigm)
IST12781E8 (tigm) IST10496D6 (tigm) IST12659C10 (tigm) IST14910A8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17165
Vector Insertion
Chr 18: 67666381 - 67672494
Public Clones CMHD-GT_493C11-3 (cmhd) IST11265F2 (tigm) IST15059F10 (tigm)
Private Clones OST448268 (lexicon) OST381025 (lexicon) OST267411 (lexicon) OST144230 (lexicon)
OST66645 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27293
Vector Insertion
Chr 18: 67665399 - 67666207
Public Clones not available
Private Clones OST64813 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15881
Vector Insertion
Chr 18: 67656830 - 67656969
Public Clones not available
Private Clones OST471117 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25784
Vector Insertion
Chr 18: 67656215 - 67656287
Public Clones not available
Private Clones OST166476 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20496
Vector Insertion
Chr 18: 67654931 - 67655016
Public Clones not available
Private Clones OST360598 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000091867
Sequence
GGATGCGGAGGCGGCGGCTCGCGGAGACGATGCTCCGGCGCTGAGGAGACGCGGCAGCCGAGCGCCGGCGACCGCAGCGACGCGGGCCGCATGGCGCAGC

CCTCCAGCCCCGGCGGCGAGGGGCCGCAGCTCGGCGCGGCCGGGGGTCCGCGCGACGCGCTGAGCCTGGAGGAGATCCTGCGGCTCTACAACCAGCCCAT

CAACGAGGAGCAGGCGTGGGCCGTGTGCTTCCAGTGCTGCGGCTCCCTGCGCGCCGCCGCCGCCCGCCGCCAGCCCCACCGCCGCGTGCGCTCGGCCGCG

CAGATCCGCGTCTGGAGGGACGGCGCCGTCACCCTGGCGCCCGCCGCCGCCGCCGCCGCGGAGGGAGAGCCGCCCCCCGCCTCCG GTCAATTGGGATAT

TCACATTGTACAGAAACAGAG GTTATTGAATCCCTGGGAATTATTATTTATAAAGCATTGGACTATGGCTTGAAGGAAAACGAAGAAAGGGAGCTGAGC

CCTCCTCTAGAGCAGCTCATCGACCAAATGGCCAATACCGTGGAGGCTGACGGGAGCAAGGATGAAGGGTACGAGGCTGCAGATGAAGGCCCGGAAGATG

AAGACGGAGAGAAGAGAAGCATCTCAGCCATCCGGTCCTATCAGGACGTTATGAAG ATCTGTGCTGCTCACCTCCCAACTGAGTCGGAGGCACCCAATC

ATTATCAGGCAGTATGTCGGGCCCTGTTCGCAGAAACCATGGAACTGCATACATTTCTGACCAAAATTAAGAGTGCAAAGGAG - UNI18721 - AAC

CTTAAGAAGATTCAAGAAATGGAAAAGGGTGATGAATCTAGCACAGATCTGGAGGACCTGAAAAATGCAGACTGG GCCCGGTTCTGGGTACAAGTGATG

AGGGATTTGCGAAATGGGGTAAAACTTAAGAAAGTCCAGCAGCGGCAGTACAACCCTCTGCCCATTGAGTACCAACTGACCCCTTATGAGATGCTCATGG

ACGACATTCGGTGCAAAAGATACACCTTGAGAAAAGTAATG GTAAATGGTGACGTCCCCCCTCGGTTGAAAAAGAGTGCTCATGAGGTCATCCTTGACT

TTATCAGATCAAGACCCCCTTTAAATCCA - UNI31419 - GTTTCAGCCAGAAAACTGAAACCAACCCCACCACGGCCACGGAGCCTCCATGAAAGA

ATATTAGAAGAAATTAAAGCAGAAAGAAAGCTTCGACCTGTGTCACCAGAAGAAATTAGACGGAGCAGACTAG - UNI31419 - TGCGGCCACTTAG

CATGTCTCACAGTTTTGACTTGTCAG - UNI17165 - - UNI31419 - ATGTCACTACGCCAGAATCTCCAAAGAATGTTGGAGAATCATCTATG

GTGAATGGAGGCTTAACATCTCAAACAAAAGAAAATGGGCTGAGCGCTGCCCAGCAGGGGTCTGCGCAGAGGAAGAGGCTCCTCAAAGCCCCAACCCTGG

CTGAACTGGACAGCTCTGACTCTGAG - UNI27293 - GAGGAAAAAAGTCTGCACAAGTCAACCAGCAGCAGCAGTGCGTCTCCCTCCCTCTATGAG

GATCCAGTACTGGAGGCCATGTGCTCCAGGAAGA AGCCTCCAAAATTCTTGCCCATCTCATCAACACCCCAGCCAGAGAGAAGGCAGCCACCGCAGAGG

CGCCACTCCATTGAGAAGGAAACACCTACGAACGTGAGGCAGTTTCTGCCACCATCCAGGCAGAGCTCACGGTCTCTT - UNI15881 - GAGGAATT

CTGCTACCCAGTGGAGTGCCTCGCTCTCACTGTGGAGGAAGTGATGCACATCCGTCAGGTCCTGGTGAAAGCAGAGCTGGAAAAGTACCAACAGTATAAG

GATGTCTACACTGCCCTGAAAAAAGGAAAG - UNI15881 - - UNI25784 - CTCTGCTTCTGTTGCCGAACCCGGAGGTTTTCCTTCTTCACCT

GGTCTTACACCTGTCAGTTCTGTAAGAG - UNI25784 - GCCCGTGTGCTCACAGTGTTGCAAAAAG - UNI20496 - ATGCGGCTGCCTTCCA

AGCCATACTCTACTCTACCTATCTTCTCTTTGGGACCTTCTGCCTTGCAAAGGGGGGAAAGCTGTTCGAGGTCAGAAAAACCCTCCACTAGTCACCATCG

GCCTCTTCGAAGTATTGCCAG GTTCTCCACAAAATCCAGGTCTGTGGACAAGTCCGATGAGGAGCTCCAGTTTCCCAAAGAGCTCATGGAGGACTGGAG

CACGATGGAGGTGTGTGTGGACTGCAAAAAGTTCATCTCCGAGATCATCAGCTCAAGCCGGCGCAGCCTGGTGCTGGCTAACAAAAGAGCCAGGTTGAAA

AGGAAGACACAGTCTTTCTACATGTCCTCGGCGGGCCCCTCGGAGTACTGCCCTTCAGAACGGACTATCAACGAGATCTGAGCCCTGTGCCTTCCCGCTC

TTTTGTGTGCAGAGCGGGCAGTGCAACAGTGCTGCAGGACTCTTCCCAGGGGTTTCCTTCACAGGCTCCGTCTGCAGCAGGTCAGGCCTGGGCTGCACCT

GAGACACAGACTCAAGGCTGTGTTCATATCAGCCGATGGTTGGTAGGAGGCAGGTCAGCCACTTGGTCATTTGCACTCAGAAAGCCTAAAACTTGATTTT

GTGTATGTGAGTCGGGAAGCTAGAAACTTCCTTAGTTCAGTTCCTCAATGTTCTTCGGATAATTTCCTGACTAAGGCAAAAAGCTTCTTGTGTGTGAAGT

CTGTCTGACGGAGTGTGGATGTTAGCACAGTTGTAAGCAGTAAGTCATATTGGCATTCCACGTGACAGTGTTCCTAGCTCATGTACATAATGTCCAAAGC

CCTGCCACACACCGGCTCCCTGGGGTGGGCCAGGTTGGCTGTCTTCTCACAGCACAAATCTAGAAGGCCTTGCTGATAATTCTCTTTGGGGCTCTGGCTG

CATCCAGCGCAGAACAATCATGTGAGCTGTACACCGCACGGGTGGCCCTTCTCTGAGCTCAGGGTCTGCCCCGGCACAAGCCTCAGTGTTTCCTGAGCTG

CTAACAGGCCTTCATTCCTATTGTGAATGTAATATGGTTTTGAATAGTTTTATAATACACGTCTAAGAATTAAGATTTTGTGGAAGTTTGAGGAAAAAGG

AAGACTAAAATTTCATCCAACAGATGAGCTGGTTTTGGTTAACTGATAGGCTGTAACAGCAGGGATGCCAGCAGAAAGGAGCTATGGCTCATACATTTTC

ACCTACATTTTCCATAACTTTATAGTGTGGCCATCGTGACTAAATTAACCACAGTTTGGTATCTGAGTCTCAAACTGAAGATTATTTTTATAAATGAATT

TTAAAAGAAAAACCTTGGCTGTTTTAAAATCTCAAGAAAATGAACCTGCTGCCATGCATAATTTTTTGATGCTTTTGCACTAGGTATCTTGTAAATGTCA

CTGCATTTCTGATGAAGGGCGACTGACAGGTAGAGGTAGTATTGTGTGTCTGAAATTGTTCAGCTCCTATGACGCACCATGGGCTGCCCTCATTTCCATA

TGCTTAGAAATAACTGGGCAATCAAATTACCACTAATGTTTGGGAAATGAGTGAAGGCACATGCACAGTGTAACTCCTGAAAGCTCTGACAAACCACCCT

CATTACCACCACTGATGACATCTCCATTTGATAAAAGGCATGCCAGTCGCATTTCACCATCATTAAGATACAGTAACATTTCCCATTAAATTGACAACGA

CACCTCAGAAATATTCCAGTAGTCATTTCTAATGCATTGAAATTTATAGTTTAGTAAATGCCTTTAAATTACTTATACTGACGAAATAAACTTTACCAGT

TGACTAACGTAATGCATGTTAGTAGTTCATCTGTACTGCATGTAGAAGTGGGCCGCCAGAAAACCCTTACAGTCCAGCTGTTTTTAAGACTAAGAGCTGT

AAAAATTGCAGTGTGTGAATCCCATTTATACAGTTTTCCCTGAGACCACCAGAACGTTACACCACAGTTAGATAGGACCACCACTGCTATGGCTCCAGGC

ATACATACATTCCAGACTGGTTTCCTGGAAGGAAGCAAGAAAGAAGGAATACACCTGTGTGGCTTTATAAGCATGCACATAGGGTAGCATGCTTCTGTAA

AATGATGATTAATTAGCATTTGACTTCCCACATAAGACACTGAGCCCACCACTCCATAAGTCACAGGTCACATTCACAAGTCAGTGATCTAGTAAATGTC

ACAGATTGGACCTCATTCCTTCAGCCTCACAGTACTGTGCATAGTGTTTGGGCATTAGGACCCCTTTACCAGAACATCAGGATATAAATTTTCCAGCACA

TTAATGGGATTTGCCAAGTGTGTTAAGAGTTCAAGTGTATACCATGCCCAGTAAACAACCTGCAGGAAGTAGTGGGGAAAAAGGGCACGAGACAAGGTAG

AAAGTATAGAAATAAAATTAGCATTGTTTGGGAGACACCAAAAAAGACATGTGCAAGACTGGCTCTTCCCCCCACGCCCCAAGCACTCATACCAAGCTAG

GATTCCATAGGCTAGGGCTTTGGGCCAGGGAGCTGATGCTGCTGGTGTGACTTGGTTTAAAAGTCCTAGCTGACACGGTTCAAGCTTCCTGTTCCTCCAG

CCACCTTGTGCAGGACCGTTTGTCCTGCTTTCCTGCTGTGTTGCTCTCTTAGTTTGACATTTGTTTATGGCTGACCCCAGAGTCTGATGCATCTCCTGAA

TCGATCTGAATGTCCCTCCTGACCCCTCCAGGTGTGAGCACCAGCCATTGGTCCCACAGACCTTGAGGTCAGAGTATGTAAAAATGCTTGTAAATATTGT

AACATACTCATTAATATTTGAAAGTCATTCTGTCATTGGCAATGGAAATTAATTCTCCCAAGATAAGCAAAAATTAAATAATTGATTTTGCACATTGACT

TAATGACCTTAATTACTTGATTTCAAGTCTCAGCCCTTTAAAATTAAACCCAAAAGTTATTATACAGTCATTCTAAAAATGATGTTTTGAAGAGATATGT

GGTTAATACCGTGAACTCACGCCATGAAATCTGTAAGGTTTTTATTTTTCTAACTGTACTAATGGAGGACTAAACTTGAGGTATGAATGTAGGAGACATG

GAAGTTTTTAAATTATGTTGCTATTTGTTCAAATAAAACAGAAATTTTGCACATTGAAGGACCATGAAGAAATGTGTCCCACTGACTGGGCTCTGACCTG

GCTTCCCAAATGTAAGCAGAGAATGGCTGACATTCCAGGGAAAACGACAGTGCTGAGTGTGCTCCAGTGAGTAGTATTTCAGCCAGGAGTGATGCCACAT

GCCTTTATTTCCAGCATTCCAGAAGTAGAAGCAGAAAATCTTTGGGATTTCAGGGCCAGCCTGGTCTACACAGTGAGACCTTGTCTCTCTCTCTCTCTCT

TTTTTTTTAAGGTATTTTATTTTAGAATTTTTGAAGGGGGAAATAAACTGGCTTTCATC
Translation
GCGGGGSRRRCSGAEETRQPSAGDRSDAGRMAQPSSPGGEGPQLGAAGGPRDALSLEEILRLYNQPINEEQAWAVCFQCCGSLRAAAARRQPHRRVRSAA

QIRVWRDGAVTLAPAAAAAAEGEPPPASG GQLGYSHCTETE VIESLGIIIYKALDYGLKENEERELSPPLEQLIDQMANTVEADGSKDEGYEAADEGP

EDEDGEKRSISAIRSYQDVMK ICAAHLPTESEAPNHYQAVCRALFAETMELHTFLTKIKSAKE - UNI18721 - NLKKIQEMEKGDESSTDLEDLK

NADW ARFWVQVMRDLRNGVKLKKVQQRQYNPLPIEYQLTPYEMLMDDIRCKRYTLRKVM VNGDVPPRLKKSAHEVILDFIRSRPPLNP - UNI3141

9 - VSARKLKPTPPRPRSLHERILEEIKA - UNI31419 -  - UNI17165 - - UNI31419 -  - UNI27293 -   - UNI15881 - 

 - UNI15881 - - UNI25784 -  - UNI25784 -  - UNI20496 -  
Transcript ENSMUST00000115050
Sequence
ACAGCAAAAAGAGTAACACAGGAACCTTCTGCTGAGAAACATGAGAAACG ATCTGTGCTGCTCACCTCCCAACTGAGTCGGAGGCACCCAATCATTATC

AGGCAGTATGTCGGGCCCTGTTCGCAGAAACCATGGAACTGCATACATTTCTGACCAAAATTAAGAGTGCAAAGGAG - UNI18721 - AACCTTAAG

AAGATTCAAGAAATGGAAAAGGGTGATGAATCTAGCACAGATCTGGAGGACCTGAAAAATGCAGACTGG GCCCGGTTCTGGGTACAAGTGATGAGGGAT

TTGCGAAATGGGGTAAAACTTAAGAAAGTCCAGCAGCGGCAGTACAACCCTCTGCCCATTGAGTACCAACTGACCCCTTATGAGATGCTCATGGACGACA

TTCGGTGCAAAAGATACACCTTGAGAAAAGTAATG GTAAATGGTGACGTCCCCCCTCGGTTGAAAAAGAGTGCTCATGAGGTCATCCTTGACTTTATCA

GATCAAGACCCCCTTTAAATCCA - UNI31419 - GTTTCAGCCAGAAAACTGAAACCAACCCCACCACGGCCACGGAGCCTCCATGAAAGAATATTA

GAAGAAATTAAAGCAGAAAGAAAGCTTCGACCTGTGTCACCAGAAGAAATTAGACGGAGCAGACTAG - UNI17165 - - UNI31419 - ATGTCA

CTACGCCAGAATCTCCAAAGAATGTTGGAGAATCATCTATGGTGAATGGAGGCTTAACATCTCAAACAAAAGAAAATGGGCTGAGCGCTGCCCAGCAGGG

GTCTGCGCAGAGGAAGAGGCTCCTCAAAGCCCCAACCCTGGCTGAACTGGACAGCTCTGACTCTGAG - UNI27293 - GAGGAAAAAAGTCTGCACA

AGTCAACCAGCAGCAGCAGTGCGTCTCCCTCCCTCTATGAGGATCCAGTACTGGAGGCCATGTGCTCCAGGAAGA AGCCTCCAAAATTCTTGCCCATCT

CATCAACACCCCAGCCAGAGAGAAGGCAGCCACCGCAGAGGCGCCACTCCATTGAGAAGGAAACACCTACGAACGTGAGGCAGTTTCTGCCACCATCCAG

GCAGAGCTCACGGTCTCTT - UNI15881 - GAGGAATTCTGCTACCCAGTGGAGTGCCTCGCTCTCACTGTGGAGGAAGTGATGCACATCCGTCAGG

TCCTGGTGAAAGCAGAGCTGGAAAAGTACCAACAGTATAAGGATGTCTACACTGCCCTGAAAAAAGGAAAG - UNI15881 - - UNI25784 - CT

CTGCTTCTGTTGCCGAACCCGGAGGTTTTCCTTCTTCACCTGGTCTTACACCTGTCAGTTCTGTAAGAG - UNI25784 - GCCCGTGTGCTCACAGT

GTTGCAAAAAG - UNI20496 - ATGCGGCTGCCTTCCAAGCCATACTCTACTCTACCTATCTTCTCTTTGGGACCTTCTGCCTTGCAAAGGGGGGAA

AGCTGTTCGAGGTCAGAAAAACCCTCCACTAGTCACCATCGGCCTCTTCGAAGTATTGCCAG GTTCTCCACAAAATCCAGGTCTGTGGACAAGTCCGAT

GAGGAGCTCCAGTTTCCCAAAGAGCTCATGGAGGACTGGAGCACGATGGAGGTGTGTGTGGACTGCAAAAAGTTCATCTCCGAGATCATCAGCTCAAGCC

GGCGCAGCCTGGTGCTGGCTAACAAAAGAGCCAGGTTGAAAAGGAAGACACAGTCTTTCTACATGTCCTCGGCGGGCCCCTCGGAGTACTGCCCTTCAGA

ACGGACTATCAACGAGATCTGAGCCCTGTGCCTTCCCGCTCTTTTGTGTGCAGAGCGGGCAGTGCAACAGTGCTGCAGGACTCTTCCCAGGGGTTTCCTT

CACAGGCTCCGTCTGCAGCAGGTCAGGCCTGGGCTGCACCTGAGACACAGACTCAAGGCTGTGTTCATATCAGCCGATGGTTGGTAGGAGGCAGGTCAGC

CACTTGGTCATTTGCACTCAGAAAGCCTAAAACTTGATTTTGTGTATGTGAGTCGGGAAGCTAGAAACTTCCTTAGTTCAGTTCCTCAATGTTCTTCGGA

TAATTTCCTGACTAAGGCAAAAAGCTTCTTGTGTGTGAAGTCTGTCTGACGGAGTGTGGATGTTAGCACAGTTGTAAGCAGTAAGTCATATTGGCATTCC

ACGTGACAGTGTTCCTAGCTCATGTACATAATGTCCAAAGCCCTGCCACACACCGGCTCCCTGGGGTGGGCCAGGTTGGCTGTCTTCTCACAGCACAAAT

CTAGAAGGCCTTGCTGATAATTCTCTTTGGGGCTCTGGCTGCATCCAGCGCAGAACAATCATGTGAGCTGTACACCGCACGGGTGGCCCTTCTCTGAGCT

CAGGGTCTGCCCCGGCACAAGCCTCAGTGTTTCCTGAGCTGCTAACAGGCCTTCATTCCTATTGTGAATGTAATATGGTTTTGAATAGTTTTATAATACA

CGTCTAAGAATTAAGATTTTGTGGAAGTTTGAGGAAAAAGGAAGACTAAAATTTCATCCAACAGATGAGCTGGTTTTGGTTAACTGATAGGCTGTAACAG

CAGGGATGCCAGCAGAAAGGAGCTATGGCTCATACATTTTCACCTACATTTTCCATAACTTTATAGTGTGGCCATCGTGACTAAATTAACCACAGTTTGG

TATCTGAGTCTCAAACTGAAGATTATTTTTATAAATGAATTTTAAAAGAAAAACCTTGGCTGTTTTAAAATCTCAAGAAAATGAACCTGCTGCCATGCAT

AATTTTTTGATGCTTTTGCACTAGGTATCTTGTAAATGTCACTGCATTTCTGATGAAGGGCGACTGACAGGTAGAGGTAGTATTGTGTGTCTGAAATTGT

TCAGCTCCTATGACGCACCATGGGCTGCCCTCATTTCCATATGCTTAGAAATAACTGGGCAATCAAATTACCACTAATGTTTGGGAAATGAGTGAAGGCA

CATGCACAGTGTAACTCCTGAAAGCTCTGACAAACCACCCTCATTACCACCACTGATGACATCTCCATTTGATAAAAGGCATGCCAGTCGCATTTCACCA

TCATTAAGATACAGTAACATTTCCCATTAAATTGACAACGACACCTCAGAAATATTCCAGTAGTCATTTCTAATGCATTGAAATTTATAGTTTAGTAAAT

GCCTTTAAATTACTTATACTGACGAAATAAACTTTACCAGTTGACTAACGTAATGCATGTTAGTAGTTCATCTGTACTGCATGTAGAAGTGGGCCGCCAG

AAAACCCTTACAGTCCAGCTGTTTTTAAGACTAAGAGCTGTAAAAATTGCAGTGTGTGAATCCCATTTATACAGTTTTCCCTGAGACCACCAGAACGTTA

CACCACAGTTAGATAGGACCACCACTGCTATGGCTCCAGGCATACATACATTCCAGACTGGTTTCCTGGAAGGAAGCAAGAAAGAAGGAATACACCTGTG

TGGCTTTATAAGCATGCACATAGGGTAGCATGCTTCTGTAAAATGATGATTAATTAGCATTTGACTTCCCACATAAGACACTGAGCCCACCACTCCATAA

GTCACAGGTCACATTCACAAGTCAGTGATCTAGTAAATGTCACAGATTGGACCTCATTCCTTCAGCCTCACAGTACTGTGCATAGTGTTTGGGCATTAGG

ACCCCTTTACCAGAACATCAGGATATAAATTTTCCAGCACATTAATGGGATTTGCCAAGTGTGTTAAGAGTTCAAGTGTATACCATGCCCAGTAAACAAC

CTGCAGGAAGTAGTGGGGAAAAAGGGCACGAGACAAGGTAGAAAGTATAGAAATAAAATTAGCATTGTTTGGGAGACACCAAAAAAGACATGTGCAAGAC

TGGCTCTTCCCCCCACGCCCCAAGCACTCATACCAAGCTAGGATTCCATAGGCTAGGGCTTTGGGCCAGGGAGCTGATGCTGCTGGTGTGACTTGGTTTA

AAAGTCCTAGCTGACACGGTTCAAGCTTCCTGTTCCTCCAGCCACCTTGTGCAGGACCGTTTGTCCTGCTTTCCTGCTGTGTTGCTCTCTTAGTTTGACA

TTTGTTTATGGCTGACCCCAGAGTCTGATGCATCTCCTGAATCGATCTGAATGTCCCTCCTGACCCCTCCAGGTGTGAGCACCAGCCATTGGTCCCACAG

ACCTTGAGGTCAGAGTATGTAAAAATGCTTGTAAATATTGTAACATACTCATTAATATTTGAAAGTCATTCTGTCATTGGCAATGGAAATTAATTCTCCC

AAGATAAGCAAAAATTAAATAATTGATTTTGCACATTGACTTAATGACCTTAATTACTTGATTTCAAGTCTCAGCCCTTTAAAATTAAACCCAAAAGTTA

TTATACAGTCATTCTAAAAATGATGTTTTGAAGAGATATGTGGTTAATACCGTGAACTCACGCCATGAAATCTGTAAGGTTTTTATTTTTCTAACTGTAC

TAATGGAGGACTAAACTTGAGGTATGAATGTAGGAGACATGGAAGTTTTTAAATTATGTTGCTATTTGTTCAAATAAAACAGAAATTTTGCACATTGAAG

GACCATGAAGAAATGTGTCCCACTGACTGGGCTCTGACCTGGCTTCCCAAATGTAAGCAGAGAATGGCTGACATTCCAGGGAAAACGACAGTGCTGAGTG

TGCTCCAGTGAGTAGTATTTCAGCCAGGAGTGATGCCACATGCCTTTATTTCCAGCATTCCAGAAGTAGAAGCAGAAAATCTTTGGGATTTCAGGGCCAG

CCTGGTCTACACAGTGAGACCTTGTCTCTCTCTCTCTCTCTTTTTTTTTAAGGTATTTTATTTTAGAATTTTTGAAGGGGGAAATAAACTGGCTTTCATC

ATAA
Translation
 MELHTFLTKIKSAKE - UNI18721 - NLKKIQEMEKGDESSTDLEDLKNADW ARFWVQVMRDLRNGVKLKKVQQRQYNPLPIEYQLTPYEMLMDD

IRCKRYTLRKVM VNGDVPPRLKKSAHEVILDFIRSRPPLNP - UNI31419 - VSARKLKPTPPRPRSLHERILEEIKAERKLRPVSPEEIRRSRLD

 - UNI17165 - - UNI31419 - DVTTPESPKNVGESSMVNGGLTSQTKENGLSAAQQGSAQRKRLLKAPTLAELDSSDSE - UNI27293 - E

EKSLHKSTSSSSASPSLYEDPVLEAMCSRKK KPPKFLPISSTPQPERRQPPQRRHSIEKETPTNVRQFLPPSRQSSRSL - UNI15881 - EEFCYP

VECLALTVEEVMHIRQVLVKAELEKYQQYKDVYTALKKGK - UNI15881 - - UNI25784 - LCFCCRTRRFSFFTWSYTCQFCKR - UNI257

84 - RPVCSQCCKK - UNI20496 - MRLPSKPYSTLPIFSLGPSALQRGESCSRSEKPSTSHHRPLRSIAR RFSTKSRSVDKSDEELQFPKELME

DWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSAGPSEYCPSERTINEI
Transcript ENSMUST00000082243
Sequence
AGAGCAGCTCATCGACCAAATGGCCAATACCGTGGAGGCTGACGGGAGCAAGGATGAAGGGTACGAGGCTGCAGATGAAGGCCCGGAAGATGAAGACGGA

GAGAAGAGAAGCATCTCAGCCATCCGGTCCTATCAGGACGTTATGAAG ATCTGTGCTGCTCACCTCCCAACTGAGTCGGAGGCACCCAATCATTATCAG

GCAGTATGTCGGGCCCTGTTCGCAGAAACCATGGAACTGCATACATTTCTGACCAAAATTAAGAGTGCAAAGGAG - UNI18721 - AACCTTAAGAA

GATTCAAGAAATGGAAAAGGGTGATGAATCTAGCACAGATCTGGAGGACCTGAAAAATGCAGACTGG GCCCGGTTCTGGGTACAAGTGATGAGGGATTT

GCGAAATGGGGTAAAACTTAAGAAAGTCCAGCAGCGGCAGTACAACCCTCTGCCCATTGAGTACCAACTGACCCCTTATGAGATGCTCATGGACGACATT

CGGTGCAAAAGATACACCTTGAGAAAAGTAATG GTAAATGGTGACGTCCCCCCTCGGTTGAAAAAGAGTGCTCATGAGGTCATCCTTGACTTTATCAGA

TCAAGACCCCCTTTAAATCCA - UNI31419 - GTTTCAGCCAGAAAACTGAAACCAACCCCACCACGGCCACGGAGCCTCCATGAAAGAATATTAGA

AGAAATTAAAGCAGAAAGAAAGCTTCGACCTGTGTCACCAGAAGAAATTAGACGGAGCAGACTAG - UNI31419 - TGCGGCCACTTAGCATGTCTC

ACAGTTTTGACTTGTCAG - UNI17165 - - UNI31419 - ATGTCACTACGCCAGAATCTCCAAAGAATGTTGGAGAATCATCTATGGTGAATGG

AGGCTTAACATCTCAAACAAAAGAAAATGGGCTGAGCGCTGCCCAGCAGGGGTCTGCGCAGAGGAAGAGGCTCCTCAAAGCCCCAACCCTGGCTGAACTG

GACAGCTCTGACTCTGAG - UNI27293 - GAGGAAAAAAGTCTGCACAAGTCAACCAGCAGCAGCAGTGCGTCTCCCTCCCTCTATGAGGATCCAGT

ACTGGAGGCCATGTGCTCCAGGAAGA AGCCTCCAAAATTCTTGCCCATCTCATCAACACCCCAGCCAGAGAGAAGGCAGCCACCGCAGAGGCGCCACTC

CATTGAGAAGGAAACACCTACGAACGTGAGGCAGTTTCTGCCACCATCCAGGCAGAGCTCACGGTCTCTT - UNI15881 - GAGGAATTCTGCTACC

CAGTGGAGTGCCTCGCTCTCACTGTGGAGGAAGTGATGCACATCCGTCAGGTCCTGGTGAAAGCAGAGCTGGAAAAGTACCAACAGTATAAGGATGTCTA

CACTGCCCTGAAAAAAGGAAAG - UNI15881 - - UNI25784 - CTCTGCTTCTGTTGCCGAACCCGGAGGTTTTCCTTCTTCACCTGGTCTTAC

ACCTGTCAGTTCTGTAAGAG - UNI25784 - GCCCGTGTGCTCACAGTGTTGCAAAAAG - UNI20496 - ATGCGGCTGCCTTCCAAGCCATAC

TCTACTCTACCTATCTTCTCTTTGGGACCTTCTGCCTTGCAAAGGGGGGAAAGCTGTTCGAGGTCAGAAAAACCCTCCACTAGTCACCATCGGCCTCTTC

GAAGTATTGCCAG GTTCTCCACAAAATCCAGGTCTGTGGACAAGTCCGATGAGGAGCTCCAGTTTCCCAAAGAGCTCATGGAGGACTGGAGCACGATGG

AGGTGTGTGTGGACTGCAAAAAGTTCATCTCCGAGATCATCAGCTCAAGCCGGCGCAGCCTGGTGCTGGCTAACAAAAGAGCCAGGTTGAAAAGGAAGAC

ACAGTCTTTCTACATGTCCTCGGCGGGCCCCTCGGAGTACTGCCCTTCAGAACGGACTATCAACGAGATCTGAGCCCTGTGCCTTCCCGCTCTTTTGTGT

GCAGAGCGGGCAGTGCAACAGTGCTGCAGGACTCTTCCCAGGGGTTTCCTTCACAGGCTCCGTCTGCAGCAGGTCAGGCCTGGGCTGCACCTGAGACACA

GACTCAAGGCTGTGTTCATATCAGCCGATGGTTGGTAGGAGGCAGGTCAGCCACTTGGTCATTTGCACTCAGAAAGCCTAAAACTTGATTTTGTGTATGT

GAGTCGGGAAGCTAGAAACTTCCTTAGTTCAGTTCCTCAATGTTCTTCGGATAATTTCCTGACTAAGGCAAAAAGCTTCTTGTGTGTGAAGTCTGTCTGA

CGGAGTGTGGATGTTAGCACAGTTGTAAGCAGTAAGTCATATTGGCATTCCACGTGACAGTGTTCCTAGCTCATGTACATAATGTCCAAAGCCCTGCCAC

ACACCGGCTCCCTGGGGTGGGCCAGGTTGGCTGTCTTCTCACAGCACAAATCTAGAAGGCCTTGCTGATAATTCTCTTTGGGGCTCTGGCTGCATCCAGC

GCAGAACAATCATGTGAGCTGTACACCGCACGGGTGGCCCTTCTCTGAGCTCAGGGTCTGCCCCGGCACAAGCCTCAGTGTTTCCTGAGCTGCTAACAGG

CCTTCATTCCTATTGTGAATGTAATATGGTTTTGAATAGTTTTATAATACACGTCTAAGAATTAAGATTTTGTGGAAGTTTGAGGAAAAAGGAAGACTAA

AATTTCATCCAACAGATGAGCTGGTTTTGGTTAACTGATAGGCTGTAACAGCAGGGATGCCAGCAGAAAGGAGCTATGGCTCATACATTTTCACCTACAT

TTTCCATAACTTTATAGTGTGGCCATCGTGACTAAATTAACCACAGTTTGGTATCTGAGTCTCAAACTGAAGATTATTTTTATAAATGAATTTTAAAAGA

AAAACCTTGGCTGTTTTAAAATCTCAAGAAAATGAACCTGCTGCCATGCATAATTTTTTGATGCTTTTGCACTAGGTATCTTGTAAATGTCACTGCATTT

CTGATGAAGGGCGACTGACAGGTAGAGGTAGTATTGTGTGTCTGAAATTGTTCAGCTCCTATGACGCACCATGGGCTGCCCTCATTTCCATATGCTTAGA

AATAACTGGGCAATCAAATTACCACTAATGTTTGGGAAATGAGTGAAGGCACATGCACAGTGTAACTCCTGAAAGCTCTGACAAACCACCCTCATTACCA

CCACTGATGACATCTCCATTTGATAAAAGGCATGCCAGTCGCATTTCACCATCATTAAGATACAGTAACATTTCCCATTAAATTGACAACGACACCTCAG

AAATATTCCAGTAGTCATTTCTAATGCATTGAAATTTATAGTTTAGTAAATGCCTTTAAATTACTTATACTGACGAAATAAACTTTACCAGTTGACTAAC

GTAATGCATGTTAGTAGTTCATCTGTACTGCATGTAGAAGTGGGCCGCCAGAAAACCCTTACAGTCCAGCTGTTTTTAAGACTAAGAGCTGTAAAAATTG

CAGTGTGTGAATCCCATTTATACAGTTTTCCCTGAGACCACCAGAACGTTACACCACAGTTAGATAGGACCACCACTGCTATGGCTCCAGGCATACATAC

ATTCCAGACTGGTTTCCTGGAAGGAAGCAAGAAAGAAGGAATACACCTGTGTGGCTTTATAAGCATGCACATAGGGTAGCATGCTTCTGTAAAATGATGA

TTAATTAGCATTTGACTTCCCACATAAGACACTGAGCCCACCACTCCATAAGTCACAGGTCACATTCACAAGTCAGTGATCTAGTAAATGTCACAGATTG

GACCTCATTCCTTCAGCCTCACAGTACTGTGCATAGTGTTTGGGCATTAGGACCCCTTTACCAGAACATCAGGATATAAATTTTCCAGCACATTAATGGG

ATTTGCCAAGTGTGTTAAGAGTTCAAGTGTATACCATGCCCAGTAAACAACCTGCAGGAAGTAGTGGGGAAAAAGGGCACGAGACAAGGTAGAAAGTATA

GAAATAAAATTAGCATTGTTTGGGAGACACCAAAAAAGACATGTGCAAGACTGGCTCTTCCCCCCACGCCCCAAGCACTCATACCAAGCTAGGATTCCAT

AGGCTAGGGCTTTGGGCCAGGGAGCTGATGCTGCTGGTGTGACTTGGTTTAAAAGTCCTAGCTGACACGGTTCAAGCTTCCTGTTCCTCCAGCCACCTTG

TGCAGGACCGTTTGTCCTGCTTTCCTGCTGTGTTGCTCTCTTAGTTTGACATTTGTTTATGGCTGACCCCAGAGTCTGATGCATCTCCTGAATCGATCTG

AATGTCCCTCCTGACCCCTCCAGGTGTGAGCACCAGCCATTGGTCCCACAGACCTTGAGGTCAGAGTATGTAAAAATGCTTGTAAATATTGTAACATACT

CATTAATATTTGAAAGTCATTCTGTCATTGGCAATGGAAATTAATTCTCCCAAGATAAGCAAAAATTAAATAATTGATTTTGCACATTGACTTAATGACC

TTAATTACTTGATTTCAAGTCTCAGCCCTTTAAAATTAAACCCAAAAGTTATTATACAGTCATTCTAAAAATGATGTTTTGAAGAGATATGTGGTTAATA

CCGTGAACTCACGCCATGAAATCTGTAAGGTTTTTATTTTTCTAACTGTACTAATGGAGGACTAAACTTGAGGTATGAATGTAGGAGACATGGAAGTTTT

TAAATTATGTTGCTATTTGTTCAAATAAAACAGAAATTTTGCACATTGAAGGACCATGAAGAAATGTGTCCCACTGACTGGGCTCTGACCTGGCTTCCCA

AATGTAAGCAGAGAATGGCTGACATTCCAGGGAAAACGACAGTGCTGAGTGTGCTCCAGTGAGTAGTATTTCAGCCAGGAGTGATGCCACATGCCTTTAT

TTCCAGCATTCCAGAAGTAGAAGCAGAAAATCTTTGGGATTTCAGGGCCAGCCTGGTCTACACAGTGAGACCTTGTCTCTCTCTCTCTCTCTTTTTTTTT

AAGGTATTTTATTTTAGAATTTTTGAAGGGGGAAATAAACTGGCTTTCATCATAA
Translation
MANTVEADGSKDEGYEAADEGPEDEDGEKRSISAIRSYQDVMK ICAAHLPTESEAPNHYQAVCRALFAETMELHTFLTKIKSAKE - UNI18721 - 

NLKKIQEMEKGDESSTDLEDLKNADW ARFWVQVMRDLRNGVKLKKVQQRQYNPLPIEYQLTPYEMLMDDIRCKRYTLRKVM VNGDVPPRLKKSAHEVI

LDFIRSRPPLNP - UNI31419 - VSARKLKPTPPRPRSLHERILEEIKAERKLRPVSPEEIRRSRLV - UNI31419 - VRPLSMSHSFDLSD -

 UNI17165 - - UNI31419 - DVTTPESPKNVGESSMVNGGLTSQTKENGLSAAQQGSAQRKRLLKAPTLAELDSSDSE - UNI27293 - EEK

SLHKSTSSSSASPSLYEDPVLEAMCSRKK KPPKFLPISSTPQPERRQPPQRRHSIEKETPTNVRQFLPPSRQSSRSL - UNI15881 - EEFCYPVE

CLALTVEEVMHIRQVLVKAELEKYQQYKDVYTALKKGK - UNI15881 - - UNI25784 - LCFCCRTRRFSFFTWSYTCQFCKR - UNI25784

 - RPVCSQCCKK - UNI20496 - MRLPSKPYSTLPIFSLGPSALQRGESCSRSEKPSTSHHRPLRSIAR RFSTKSRSVDKSDEELQFPKELMEDW

STMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSAGPSEYCPSERTINEI
Transcript ENSMUST00000045105
Sequence
AGAGCAGCTCATCGACCAAATGGCCAATACCGTGGAGGCTGACGGGAGCAAGGATGAAGGGTACGAGGCTGCAGATGAAGGCCCGGAAGATGAAGACGGA

GAGAAGAGAAGCATCTCAGCCATCCGGTCCTATCAGGACGTTATGAAG ATCTGTGCTGCTCACCTCCCAACTGAGTCGGAGGCACCCAATCATTATCAG

GCAGTATGTCGGGCCCTGTTCGCAGAAACCATGGAACTGCATACATTTCTGACCAAAATTAAGAGTGCAAAGGAG - UNI18721 - AACCTTAAGAA

GATTCAAGAAATGGAAAAGGGTGATGAATCTAGCACAGATCTGGAGGACCTGAAAAATGCAGACTGG GCCCGGTTCTGGGTACAAGTGATGAGGGATTT

GCGAAATGGGGTAAAACTTAAGAAAGTCCAGCAGCGGCAGTACAACCCTCTGCCCATTGAGTACCAACTGACCCCTTATGAGATGCTCATGGACGACATT

CGGTGCAAAAGATACACCTTGAGAAAAGTAATG GTAAATGGTGACGTCCCCCCTCGGTTGAAAAAGAGTGCTCATGAGGTCATCCTTGACTTTATCAGA

TCAAGACCCCCTTTAAATCCA - UNI31419 - GTTTCAGCCAGAAAACTGAAACCAACCCCACCACGGCCACGGAGCCTCCATGAAAGAATATTAGA

AGAAATTAAAGCAGAAAGAAAGCTTCGACCTGTGTCACCAGAAGAAATTAGACGGAGCAGACTAG - UNI17165 - - UNI31419 - ATGTCACT

ACGCCAGAATCTCCAAAGAATGTTGGAGAATCATCTATGGTGAATGGAGGCTTAACATCTCAAACAAAAGAAAATGGGCTGAGCGCTGCCCAGCAGGGGT

CTGCGCAGAGGAAGAGGCTCCTCAAAGCCCCAACCCTGGCTGAACTGGACAGCTCTGACTCTGAG - UNI27293 - GAGGAAAAAAGTCTGCACAAG

TCAACCAGCAGCAGCAGTGCGTCTCCCTCCCTCTATGAGGATCCAGTACTGGAGGCCATGTGCTCCAGGAAGA AGCCTCCAAAATTCTTGCCCATCTCA

TCAACACCCCAGCCAGAGAGAAGGCAGCCACCGCAGAGGCGCCACTCCATTGAGAAGGAAACACCTACGAACGTGAGGCAGTTTCTGCCACCATCCAGGC

AGAGCTCACGGTCTCTT GTTCCTAGGATAACCGGTGTATGGCCCAGGACGCCTTTCCGACCACTTTTCTCTACCATACAAACAGCTTCTCTGCTGAGCT

CTCATCCTTTTGAAGCAGCCATGTTTGGGGTAGCAGGGGCTATGTATTATCTGTTTGAGAGAGCTTTTACCAGCAGGTGGAAACCCTCAAAG - UNI15

881 - GAGGAATTCTGCTACCCAGTGGAGTGCCTCGCTCTCACTGTGGAGGAAGTGATGCACATCCGTCAGGTCCTGGTGAAAGCAGAGCTGGAAAAGT

ACCAACAGTATAAGGATGTCTACACTGCCCTGAAAAAAGGAAAG - UNI15881 - - UNI25784 - CTCTGCTTCTGTTGCCGAACCCGGAGGTT

TTCCTTCTTCACCTGGTCTTACACCTGTCAGTTCTGTAAGAG - UNI25784 - GCCCGTGTGCTCACAGTGTTGCAAAAAG - UNI20496 - AT

GCGGCTGCCTTCCAAGCCATACTCTACTCTACCTATCTTCTCTTTGGGACCTTCTGCCTTGCAAAGGGGGGAAAGCTGTTCGAGGTCAGAAAAACCCTCC

ACTAGTCACCATCGGCCTCTTCGAAGTATTGCCAG GTTCTCCACAAAATCCAGGTCTGTGGACAAGTCCGATGAGGAGCTCCAGTTTCCCAAAGAGCTC

ATGGAGGACTGGAGCACGATGGAGGTGTGTGTGGACTGCAAAAAGTTCATCTCCGAGATCATCAGCTCAAGCCGGCGCAGCCTGGTGCTGGCTAACAAAA

GAGCCAGGTTGAAAAGGAAGACACAGTCTTTCTACATGTCCTCGGCGGGCCCCTCGGAGTACTGCCCTTCAGAACGGACTATCAACGAGATCTGAGCCCT

GTGCCTTCCCGCTCTTTTGTGTGCAGAGCGGGCAGTGCAACAGTGCTGCAGGACTCTTCCCAGGGGTTTCCTTCACAGGCTCCGTCTGCAGCAGGTCAGG

CCTGGGCTGCACCTGAGACACAGACTCAAGGCTGTGTTCATATCAGCCGATGGTTGGTAGGAGGCAGGTCAGCCACTTGGTCATTTGCACTCAGAAAGCC

TAAAACTTGATTTTGTGTATGTGAGTCGGGAAGCTAGAAACTTCCTTAGTTCAGTTCCTCAATGTTCTTCGGATAATTTCCTGACTAAGGCAAAAAGCTT

CTTGTGTGTGAAGTCTGTCTGACGGAGTGTGGATGTTAGCACAGTTGTAAGCAGTAAGTCATATTGGCATTCCACGTGACAGTGTTCCTAGCTCATGTAC

ATAATGTCCAAAGCCCTGCCACACACCGGCTCCCTGGGGTGGGCCAGGTTGGCTGTCTTCTCACAGCACAAATCTAGAAGGCCTTGCTGATAATTCTCTT

TGGGGCTCTGGCTGCATCCAGCGCAGAACAATCATGTGAGCTGTACACCGCACGGGTGGCCCTTCTCTGAGCTCAGGGTCTGCCCCGGCACAAGCCTCAG

TGTTTCCTGAGCTGCTAACAGGCCTTCATTCCTATTGTGAATGTAATATGGTTTTGAATAGTTTTATAATACACGTCTAAGAATTAAGATTTTGTGGAAG

TTTGAGGAAAAAGGAAGACTAAAATTTCATCCAACAGATGAGCTGGTTTTGGTTAACTGATAGGCTGTAACAGCAGGGATGCCAGCAGAAAGGAGCTATG

GCTCATACATTTTCACCTACATTTTCCATAACTTTATAGTGTGGCCATCGTGACTAAATTAACCACAGTTTGGTATCTGAGTCTCAAACTGAAGATTATT

TTTATAAATGAATTTTAAAAGAAAAACCTTGGCTGTTTTAAAATCTCAAGAAAATGAACCTGCTGCCATGCATAATTTTTTGATGCTTTTGCACTAGGTA

TCTTGTAAATGTCACTGCATTTCTGATGAAGGGCGACTGACAGGTAGAGGTAGTATTGTGTGTCTGAAATTGTTCAGCTCCTATGACGCACCATGGGCTG

CCCTCATTTCCATATGCTTAGAAATAACTGGGCAATCAAATTACCACTAATGTTTGGGAAATGAGTGAAGGCACATGCACAGTGTAACTCCTGAAAGCTC

TGACAAACCACCCTCATTACCACCACTGATGACATCTCCATTTGATAAAAGGCATGCCAGTCGCATTTCACCATCATTAAGATACAGTAACATTTCCCAT

TAAATTGACAACGACACCTCAGAAATATTCCAGTAGTCATTTCTAATGCATTGAAATTTATAGTTTAGTAAATGCCTTTAAATTACTTATACTGACGAAA

TAAACTTTACCAGTTGACTAACGTAATGCATGTTAGTAGTTCATCTGTACTGCATGTAGAAGTGGGCCGCCAGAAAACCCTTACAGTCCAGCTGTTTTTA

AGACTAAGAGCTGTAAAAATTGCAGTGTGTGAATCCCATTTATACAGTTTTCCCTGAGACCACCAGAACGTTACACCACAGTTAGATAGGACCACCACTG

CTATGGCTCCAGGCATACATACATTCCAGACTGGTTTCCTGGAAGGAAGCAAGAAAGAAGGAATACACCTGTGTGGCTTTATAAGCATGCACATAGGGTA

GCATGCTTCTGTAAAATGATGATTAATTAGCATTTGACTTCCCACATAAGACACTGAGCCCACCACTCCATAAGTCACAGGTCACATTCACAAGTCAGTG

ATCTAGTAAATGTCACAGATTGGACCTCATTCCTTCAGCCTCACAGTACTGTGCATAGTGTTTGGGCATTAGGACCCCTTTACCAGAACATCAGGATATA

AATTTTCCAGCACATTAATGGGATTTGCCAAGTGTGTTAAGAGTTCAAGTGTATACCATGCCCAGTAAACAACCTGCAGGAAGTAGTGGGGAAAAAGGGC

ACGAGACAAGGTAGAAAGTATAGAAATAAAATTAGCATTGTTTGGGAGACACCAAAAAAGACATGTGCAAGACTGGCTCTTCCCCCCACGCCCCAAGCAC

TCATACCAAGCTAGGATTCCATAGGCTAGGGCTTTGGGCCAGGGAGCTGATGCTGCTGGTGTGACTTGGTTTAAAAGTCCTAGCTGACACGGTTCAAGCT

TCCTGTTCCTCCAGCCACCTTGTGCAGGACCGTTTGTCCTGCTTTCCTGCTGTGTTGCTCTCTTAGTTTGACATTTGTTTATGGCTGACCCCAGAGTCTG

ATGCATCTCCTGAATCGATCTGAATGTCCCTCCTGACCCCTCCAGGTGTGAGCACCAGCCATTGGTCCCACAGACCTTGAGGTCAGAGTATGTAAAAATG

CTTGTAAATATTGTAACATACTCATTAATATTTGAAAGTCATTCTGTCATTGGCAATGGAAATTAATTCTCCCAAGATAAGCAAAAATTAAATAATTGAT

TTTGCACATTGACTTAATGACCTTAATTACTTGATTTCAAGTCTCAGCCCTTTAAAATTAAACCCAAAAGTTATTATACAGTCATTCTAAAAATGATGTT

TTGAAGAGATATGTGGTTAATACCGTGAACTCACGCCATGAAATCTGTAAGGTTTTTATTTTTCTAACTGTACTAATGGAGGACTAAACTTGAGGTATGA

ATGTAGGAGACATGGAAGTTTTTAAATTATGTTGCTATTTGTTCAAATAAAACAGAAATTTTGCACATTGAAGGACCATGAAGAAATGTGTCCCACTGAC

TGGGCTCTGACCTGGCTTCCCAAATGTAAGCAGAGAATGGCTGACATTCCAGGGAAAACGACAGTGCTGAGTGTGCTCCAGTGAGTAGTATTTCAGCCAG

GAGTGATGCCACATGCCTTTATTTCCAGCATTCCAGAAGTAGAAGCAGAAAATCTTTGGGATTTCAGGGCCAGCCTGGTCTACACAGTGAGACCTTGTCT

CTCTCTCTCTCTCTTTTTTTTTAAGGTATTTTATTTTAGAATTTTTGAAGGGGGAAATAAACTGGCTTTCATCATAA
Translation
MANTVEADGSKDEGYEAADEGPEDEDGEKRSISAIRSYQDVMK ICAAHLPTESEAPNHYQAVCRALFAETMELHTFLTKIKSAKE - UNI18721 - 

NLKKIQEMEKGDESSTDLEDLKNADW ARFWVQVMRDLRNGVKLKKVQQRQYNPLPIEYQLTPYEMLMDDIRCKRYTLRKVM VNGDVPPRLKKSAHEVI

LDFIRSRPPLNP - UNI31419 - VSARKLKPTPPRPRSLHERILEEIKAERKLRPVSPEEIRRSRLD - UNI17165 - - UNI31419 - DVT

TPESPKNVGESSMVNGGLTSQTKENGLSAAQQGSAQRKRLLKAPTLAELDSSDSE - UNI27293 - EEKSLHKSTSSSSASPSLYEDPVLEAMCSRK

K KPPKFLPISSTPQPERRQPPQRRHSIEKETPTNVRQFLPPSRQSSRSL VPRITGVWPRTPFRPLFSTIQTASLLSSHPFEAAMFGVAGAMYYLFERA

FTSRWKPSK - UNI15881 - EEFCYPVECLALTVEEVMHIRQVLVKAELEKYQQYKDVYTALKKGK - UNI15881 - - UNI25784 - LCFC

CRTRRFSFFTWSYTCQFCKR - UNI25784 - RPVCSQCCKK - UNI20496 - MRLPSKPYSTLPIFSLGPSALQRGESCSRSEKPSTSHHRPLR

SIAR RFSTKSRSVDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSAGPSEYCPSERTINEI

For any suggestions or comments, please send an email to unitrap@crg.es