Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024589 (Nedd4l)
Chromosomal location
Chr 18: 65080790 - 65372961 (+)
Description
neural precursor cell expressed, developmentally down-regulated gene 4-like Gene [Source:MGI Symbol;Acc:MGI:1933754]
RefSeq_dna
NM_031881 
RefSeq_peptide
NP_114087.2 NP_001107858.1 
UniGene
Mm.98668 Mm.401832 
MGI
MGI:1933754 
Uniprot/SWISSPROT
Q8CFI0 
Uniprot/SPTREMBL
Q641N8 Q3TQK9 
Human Ortholog
ENSG00000049759 (NEDD4L)
Omim not available
UniTrap UNI21138
Vector Insertion
Chr 18: 65080922 - 65157001
Public Clones (sanger) E122B03 (ggtc) IST14238F9 (tigm) IST11376A4 (tigm)
Private Clones OST340188 (lexicon) OST327022 (lexicon) OST131040 (lexicon) OST64788 (lexicon)
OST62555 (lexicon) OST58347 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37541
Vector Insertion
Chr 18: 65157076 - 65183547
Public Clones (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30027
Vector Insertion
Chr 18: 65183644 - 65210695
Public Clones D150G09 (ggtc) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27602
Vector Insertion
Chr 18: 65234377 - 65234460
Public Clones not available
Private Clones OST55601 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI876
Vector Insertion
Chr 18: 65322826 - 65325225
Public Clones CA0066 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7762
Vector Insertion
Chr 18: 65333897 - 65338572
Public Clones (sanger) RRN177 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3234
Vector Insertion
Chr 18: 65365348 - 65367702
Public Clones AL0669 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000080418
Sequence
TGCTGTTGTTAAGGAAAACAGACCAACCATCTGCATCTAGACCAGCCTTCCTCTCCCTCGCTCCCTTTTAGAGGAGGTTTTCCTGCCTGGAATCTG - U

NI27602 - - UNI30027 - CGACCCATACGTGAAGCTGTCCTTGTATGTAGCTGATGAGAATAGAGAACTTGCTCTGGTTCAAACCAAGACAATTA

AAAAG - UNI27602 - ACGCTGAACCCAAAGTGGAATGAAGAGTTTTATTTTAGG GTAAATCCATCTAATCACAGGCTCCTATTTGAAGTATTTGA

CGAGAACAGATTG ACACGAGACGACTTCCTGGGCCAGGTGGACGTGCCTCTTAGTCACCTTCCG ACAGAAGATCCAACCATGGAGAGACCCTATACAT

TTAAGGATTTTCTCCTGCGACCTAGAAG TCATAAATCTCGAGTCAAGGGGTTTTTGAGGTTGAAAATGGCCTACATGCCGAAAAACGGAGGTCAGGATG

AAGAAAACAGCGAGCAGAGGGATGACATGGAG CATGGATGGGAAGTGGTTGACTCCAACGACTCAGCTTCCCAGCACCAGGAGGAGCTCCCCCCTCCTC

CCCTGCCGCCAGGATGGGAAGAGAAAGTGGACAATTTAGGCCGAACTTACTATGTCAACCACAACAACAGGAGTACTCAGTGGCACCGACCCAGCTTGAT

 GGATGTGTCCTCGGAATCAGACAATAACATCAGGCAGATCAACCAGGAGGCTGCACACCGACGCTTCCGCTCTCGGAGGCACATTAGTGAAGATTTGGA

GCCTGAGGCCTCTGAAGGCGGTGGAGAAGGCCCTGAG CCTTGGGAGACCATTTCAGAGGAAATGAACATGGCAGGAGATTCTCTCAGCCTGGCTCTGCC

CCCACCGCCTGCCTCCCCAGTGTCCCGGACCAGCCCCCAGGAGCTGTCGGAAGAAGTGAGCCGAAGGTTGCAGATCACTCCGGACTCCAACGGGGAACAG

TTCAGTTCTCTGATT - UNI876 - CAGAGAGAGCCCTCGTCAAGGCTTCGGTCCTGCAGTGTTACCGACACGGTTGCTGAGCAAGCTCACCTTCCAC

CG CCCAGCACCCCAACTAGGCGAGCCCGTTCGTCAACTGTCACGGGTGGTGAGGAATCCACG CCATCAGTGGCCTATGTACATACCACGCCGGGCCTG

CCTTCAGGCTGGGAAGAAAGAAAGGATGCAAAGGGACGCACATACTATGTCAATCATAACAATCGAACCACAACTTGGACTCGGCCAATCATGCAG CTT

GCAGAAGACGGTGCCTCCGGATCAGCCACAAACAGTAACAACCACCTAGTCGAACCCCAGATCCGCCGGCCCCGTAGCCTCAGCTCGCCAACAGTAACTT

TATCTGCCCCACTGGAG GGTGCCAAGGATTCACCCATCCGCCGTGCCGTGAAAGATACCCTTTCCAATCCACAGTCCCCTCAGCCATCACCTTACAACT

CCCCCAAACCACAACACAAAGTCACACAGAGCTTCCTGCCACCAGGCTGGGAGATGAGGATAGCCCCCAACGGCCGACCCTTCTTCATTGACCATAACAC

AAAGACTACAACCTGG - UNI7762 - GAAGATCCACGGTTGAAATTTCCAGTACACATGCGGTCAAAAGCATCTTTAAACCCCAATGACCTGGGCCC

TCTTCCT CCTGGCTGGGAAGAGAGGATCCACTTGGATGGCCGCACGTTTTACATTGACCATA ATAGTAAAATTACCCAGTGGGAAGATCCAAGACTAC

AGAACCCAGCCATCACTGGTCCG GCTGTTCCGTACTCCAGAGAGTTTAAGCAGAAATACGACTACTTTAGGAAGAAATTAAAGAAGCCT GCTGATATT

CCAAACAGGTTTGAAATGAAACTTCACAGAAACAACATATTTGAAGAGTCCTATCGGAGGATCATGTCTGTAAAGAGACCTGACGTCCTAAAGGCTAGGC

TGTGGATTGAGTTTGAATCAGAGAAAGGCCTGGACTATGGGGGCGTGGCCAGAGAATGGTTCTTCTTACTGTCCAAAGAGATGTTTAACCCCTACTATGG

CCTCTTCGAGTACTCTGCCAC GGACAACTACACACTTCAGATCAATCCCAACTCAGGCCTCTGTAATGAAGACCATTTGTCCTATTTCACCTTCATTGG

AAGAGTTGCTGGCCTAGCGGTGTTTCATGGGAAACTCTTAGATG GATTCTTCATTCGACCATTCTACAAGATGATGCTGGGGAAGCAGATAACGCTGAA

CGACATGGAGTCCGTG GACAGCGAGTACTACAACTCTTTGAAGTGGATCTTAGAAAACGACCCCACGGAACTTGACCTCATGTTCTGCATAGACGAAGA

GAACTTTGGGCAG ACATACCAAGTGGATCTGAAGCCCAACGGGTCAGAAATAATGGTAACCAATGAGAACAAACGAGAATACATTGA CTTAGTCATCC

AGTGGAGATTTGTGAACAGGGTCCAGAAGCAAATGAATGCCTTCTTGGAG - UNI3234 - GGATTTACAGAACTTCTTCCAATCGACTTGATTAAAA

TTTTTGATGAAAATGAGCTGGAG TTGCTGATGTGCGGCCTTGGTGATGTCGACGTGAACGACTGGAGACAGCACTCTATTTACAAGAACGGCTACTGCC

CCAACCACCCTGTCATCCAGTGGTTCTGGAAG GCCGTGCTCCTGATGGATGCTGAGAAGCGCATCCGGTTACTACAGTTTGTCACAGGCACCTCCAGAG

TACCCATGAATGGATTTGCCGAACTCTATG GTTCCAATGGTCCTCAGCTGTTTACAATAGAGCAATGGGGCAGTCCCGAAAAACTACCCAGAGCTCATA

CATG CTTTAATCGCCTTGATTTACCTCCATATGAAACCTTTGAAGATTTACGGGAGAAACTTCTCATGGCTGTGGAAAACGCTCAAGGCTTCGAAGGTG

TGGATTAAGGAAGGCTCCAGCGTCCGGGGCACTGCCCTTCCAGCAAGTTCCAAGCGCACTTTTGCATTTGCCGAGCAGACTTTTGCAGAGCCGGTGGCAG

AAGCAGTGGCCTGGCCCGGCTCTGGAGCCCAGCTTGTCTGGGCCCTGCCCAAGTTCCGCCAGGGAACCCAGCCCCAGCTCAAGTGCCGCCCCCTCACCGC

CAATTCTCAACTGGTTGCCGTGTACACTGATTACATTTCAGGAGGACGTGTTCTATTTATGTTGTGCCTCTGCAGGCAAAGCCCTTAATAAATATTTTGC

ATACTTTCTAATGACAATGAATGGAATTAATCACGCTACAGGTATAGTATTACAACTCATGTTTACTTTTTAAAATGATTTAGACTGATTTTCAGCTTTT

ATTTCATTACAATTAAAGATGTCTCATGT
Translation
 - UNI27602 - - UNI30027 -  - UNI27602 -    MERPYTFKDFLLRPRS SHKSRVKGFLRLKMAYMPKNGGQDEENSEQRDDME HGW

EVVDSNDSASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNNRSTQWHRPSLM MDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEPEASEGGGEGPE

 PWETISEEMNMAGDSLSLALPPPPASPVSRTSPQELSEEVSRRLQITPDSNGEQFSSLI - UNI876 - QREPSSRLRSCSVTDTVAEQAHLPP PS

TPTRRARSSTVTGGEEST PSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQ LAEDGASGSATNSNNHLVEPQIRRPRSLSSPTVTLS

APLE GAKDSPIRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTW - UNI7762 - EDPRLKFPVHMRSKAS

LNPNDLGPLP PGWEERIHLDGRTFYIDHN NSKITQWEDPRLQNPAITGP AVPYSREFKQKYDYFRKKLKKP ADIPNRFEMKLHRNNIFEESYRRIM

SVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSAT TDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDG GFFI

RPFYKMMLGKQITLNDMESV DSEYYNSLKWILENDPTELDLMFCIDEENFGQ TYQVDLKPNGSEIMVTNENKREYID DLVIQWRFVNRVQKQMNAFL

E - UNI3234 - GFTELLPIDLIKIFDENELE LLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWK AVLLMDAEKRIRLLQFVTGTSRVPMNGF

AELYG GSNGPQLFTIEQWGSPEKLPRAHTC CFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD
Transcript ENSMUST00000091871
Sequence
ATACACTACTTTGGAGCAAGGAAGGCAGAAGACCAGACAGGGTGCCCTAGGGTTGCCCAGGTAGACTTCTATCAACACCAGTCCAACAGCACACATGCCT

TGTTTGTCTTGATTCTCGAGGACAACCACAG - UNI27602 - CGACCCATACGTGAAGCTGTCCTTGTATGTAGCTGATGAGAATAGAGAACTTGCT

CTGGTTCAAACCAAGACAATTAAAAAG - UNI27602 - ACGCTGAACCCAAAGTGGAATGAAGAGTTTTATTTTAGG GTAAATCCATCTAATCACA

GGCTCCTATTTGAAGTATTTGACGAGAACAGATTG ACACGAGACGACTTCCTGGGCCAGGTGGACGTGCCTCTTAGTCACCTTCCG ACAGAAGATCCA

ACCATGGAGAGACCCTATACATTTAAGGATTTTCTCCTGCGACCTAGAAG TCATAAATCTCGAGTCAAGGGGTTTTTGAGGTTGAAAATGGCCTACATG

CCGAAAAACGGAGGTCAGGATGAAGAAAACAGCGAGCAGAGGGATGACATGGAG CATGGATGGGAAGTGGTTGACTCCAACGACTCAGCTTCCCAGCAC

CAGGAGGAGCTCCCCCCTCCTCCCCTGCCGCCAGGATGGGAAGAGAAAGTGGACAATTTAGGCCGAACTTACTATGTCAACCACAACAACAGGAGTACTC

AGTGGCACCGACCCAGCTTGAT GGATGTGTCCTCGGAATCAGACAATAACATCAGGCAGATCAACCAGGAGGCTGCACACCGACGCTTCCGCTCTCGGA

GGCACATTAGTGAAGATTTGGAGCCTGAGGCCTCTGAAGGCGGTGGAGAAGGCCCTGAG CCTTGGGAGACCATTTCAGAGGAAATGAACATGGCAGGAG

ATTCTCTCAGCCTGGCTCTGCCCCCACCGCCTGCCTCCCCAGTGTCCCGGACCAGCCCCCAGGAGCTGTCGGAAGAAGTGAGCCGAAGGTTGCAGATCAC

TCCGGACTCCAACGGGGAACAGTTCAGTTCTCTGATT - UNI876 - CAGAGAGAGCCCTCGTCAAGGCTTCGGTCCTGCAGTGTTACCGACACGGTT

GCTGAGCAAGCTCACCTTCCACCG GGTGCCAAGGATTCACCCATCCGCCGTGCCGTGAAAGATACCCTTTCCAATCCACAGTCCCCTCAGCCATCACCT

TACAACTCCCCCAAACCACAACACAAAGTCACACAGAGCTTCCTGCCACCAGGCTGGGAGATGAGGATAGCCCCCAACGGCCGACCCTTCTTCATTGACC

ATAACACAAAGACTACAACCTGG - UNI7762 - GAAGATCCACGGTTGAAATTTCCAGTACACATGCGGTCAAAAGCATCTTTAAACCCCAATGACC

TGGGCCCTCTTCCT CCTGGCTGGGAAGAGAGGATCCACTTGGATGGCCGCACGTTTTACATTGACCATA ATAGTAAAATTACCCAGTGGGAAGATCCA

AGACTACAGAACCCAGCCATCACTGGTCCG GCTGTTCCGTACTCCAGAGAGTTTAAGCAGAAATACGACTACTTTAGGAAGAAATTAAAGAAGCCT GC

TGATATTCCAAACAGGTTTGAAATGAAACTTCACAGAAACAACATATTTGAAGAGTCCTATCGGAGGATCATGTCTGTAAAGAGACCTGACGTCCTAAAG

GCTAGGCTGTGGATTGAGTTTGAATCAGAGAAAGGCCTGGACTATGGGGGCGTGGCCAGAGAATGGTTCTTCTTACTGTCCAAAGAGATGTTTAACCCCT

ACTATGGCCTCTTCGAGTACTCTGCCAC GGACAACTACACACTTCAGATCAATCCCAACTCAGGCCTCTGTAATGAAGACCATTTGTCCTATTTCACCT

TCATTGGAAGAGTTGCTGGCCTAGCGGTGTTTCATGGGAAACTCTTAGATG GATTCTTCATTCGACCATTCTACAAGATGATGCTGGGGAAGCAGATAA

CGCTGAACGACATGGAGTCCGTG GACAGCGAGTACTACAACTCTTTGAAGTGGATCTTAGAAAACGACCCCACGGAACTTGACCTCATGTTCTGCATAG

ACGAAGAGAACTTTGGGCAG ACATACCAAGTGGATCTGAAGCCCAACGGGTCAGAAATAATGGTAACCAATGAGAACAAACGAGAATACATTGA CTTA

GTCATCCAGTGGAGATTTGTGAACAGGGTCCAGAAGCAAATGAATGCCTTCTTGGAG - UNI3234 - GGATTTACAGAACTTCTTCCAATCGACTTG

ATTAAAATTTTTGATGAAAATGAGCTGGAG TTGCTGATGTGCGGCCTTGGTGATGTCGACGTGAACGACTGGAGACAGCACTCTATTTACAAGAACGGC

TACTGCCCCAACCACCCTGTCATCCAGTGGTTCTGGAAG GCCGTGCTCCTGATGGATGCTGAGAAGCGCATCCGGTTACTACAGTTTGTCACAGGCACC

TCCAGAGTACCCATGAATGGATTTGCCGAACTCTATG GTTCCAATGGTCCTCAGCTGTTTACAATAGAGCAATGGGGCAGTCCCGAAAAACTACCCAGA

GCTCATACATG CTTTAATCGCCTTGATTTACCTCCATATGAAACCTTTGAAGATTTACGGGAGAAACTTCTCATGGCTGTGGAAAACGCTCAAGGCTTC

GAAGGTGTGGATTAAGGAAGGCTCCAGCGTCCGGGGCACTGCCCTTCCAGCAAGTTCCAAGCGCACTTTTGCATTTGCCGAGCAGACTTTTGCAGAGCCG

GTGGCAGAAGCAGTGGCCTGGCCCGGCTCTGGAGCCCAGCTTGTCTGGGCCCTGCCCAAGTTCCGCCAGGGAACCCAGCCCCAGCTCAAGTGCCGCCCCC

TCACCGCCAATTCTCAACTGGTTGCCGTGTACACTGATTACATTTCAGGAGGACGTGTTCTATTTATGTTGTGCCTCTGCAGGCAAAGCCCTTAATAAAT

ATTTTGCATACTTTCTAATGACAATGAATGGAATTAATCACGCTACAGGTATAGTATTACAACTCATGTTTACTTTTTAAAATGATTTAGACTGATTTTC

AGCTTTTATTTCATTACAATTAAAGATGTCTCATGT
Translation
IHYFGARKAEDQTGCPRVAQVDFYQHQSNSTHALFVLILEDNHS - UNI27602 - SDPYVKLSLYVADENRELALVQTKTIKK - UNI27602 - 

TLNPKWNEEFYFR VNPSNHRLLFEVFDENRL TRDDFLGQVDVPLSHLP TEDPTMERPYTFKDFLLRPRS SHKSRVKGFLRLKMAYMPKNGGQDEEN

SEQRDDME HGWEVVDSNDSASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNNRSTQWHRPSLM MDVSSESDNNIRQINQEAAHRRFRSRRHISEDLE

PEASEGGGEGPE PWETISEEMNMAGDSLSLALPPPPASPVSRTSPQELSEEVSRRLQITPDSNGEQFSSLI - UNI876 - QREPSSRLRSCSVTDT

VAEQAHLPP GAKDSPIRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTW - UNI7762 - EDPRLKFPVHM

RSKASLNPNDLGPLP PGWEERIHLDGRTFYIDHN NSKITQWEDPRLQNPAITGP AVPYSREFKQKYDYFRKKLKKP ADIPNRFEMKLHRNNIFEES

YRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSAT TDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDG

 GFFIRPFYKMMLGKQITLNDMESV DSEYYNSLKWILENDPTELDLMFCIDEENFGQ TYQVDLKPNGSEIMVTNENKREYID DLVIQWRFVNRVQKQ

MNAFLE - UNI3234 - GFTELLPIDLIKIFDENELE LLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWK AVLLMDAEKRIRLLQFVTGTSRV

PMNGFAELYG GSNGPQLFTIEQWGSPEKLPRAHTC CFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD
Transcript ENSMUST00000025485
Sequence
ATGTCTTTATGTGAGGCTCCAGTTCATGTGGGGGACAAAGAGCTTAAATATTTTCAAATTCCGCAGATGCTCAGCCAACTCAGCTTGCTAGCCTCACACC

ATAGCAGGGGCCTCGAGTTCAGCGGCGGACAG - UNI21138 - GGAGAATCCCGTATCCTCAGAGTAAAAGTTGTTTCTGGAATTGACCTCGCCAAG

AAGGACATATTTGGAGCCAG - UNI27602 - - UNI30027 - CGACCCATACGTGAAGCTGTCCTTGTATGTAGCTGATGAGAATAGAGAACTTG

CTCTGGTTCAAACCAAGACAATTAAAAAG - UNI27602 - ACGCTGAACCCAAAGTGGAATGAAGAGTTTTATTTTAGG GTAAATCCATCTAATCA

CAGGCTCCTATTTGAAGTATTTGACGAGAACAGATTG ACACGAGACGACTTCCTGGGCCAGGTGGACGTGCCTCTTAGTCACCTTCCG ACAGAAGATC

CAACCATGGAGAGACCCTATACATTTAAGGATTTTCTCCTGCGACCTAGAAG TCATAAATCTCGAGTCAAGGGGTTTTTGAGGTTGAAAATGGCCTACA

TGCCGAAAAACGGAGGTCAGGATGAAGAAAACAGCGAGCAGAGGGATGACATGGAG CATGGATGGGAAGTGGTTGACTCCAACGACTCAGCTTCCCAGC

ACCAGGAGGAGCTCCCCCCTCCTCCCCTGCCGCCAGGATGGGAAGAGAAAGTGGACAATTTAGGCCGAACTTACTATGTCAACCACAACAACAGGAGTAC

TCAGTGGCACCGACCCAGCTTGAT GGATGTGTCCTCGGAATCAGACAATAACATCAGGCAGATCAACCAGGAGGCTGCACACCGACGCTTCCGCTCTCG

GAGGCACATTAGTGAAGATTTGGAGCCTGAGGCCTCTGAAGGCGGTGGAGAAGGCCCTGAG CCTTGGGAGACCATTTCAGAGGAAATGAACATGGCAGG

AGATTCTCTCAGCCTGGCTCTGCCCCCACCGCCTGCCTCCCCAGTGTCCCGGACCAGCCCCCAGGAGCTGTCGGAAGAAGTGAGCCGAAGGTTGCAGATC

ACTCCGGACTCCAACGGGGAACAGTTCAGTTCTCTGATT - UNI876 - CAGAGAGAGCCCTCGTCAAGGCTTCGGTCCTGCAGTGTTACCGACACGG

TTGCTGAGCAAGCTCACCTTCCACCG CCATCAGTGGCCTATGTACATACCACGCCGGGCCTGCCTTCAGGCTGGGAAGAAAGAAAGGATGCAAAGGGAC

GCACATACTATGTCAATCATAACAATCGAACCACAACTTGGACTCGGCCAATCATGCAG CTTGCAGAAGACGGTGCCTCCGGATCAGCCACAAACAGTA

ACAACCACCTAGTCGAACCCCAGATCCGCCGGCCCCGTAGCCTCAGCTCGCCAACAGTAACTTTATCTGCCCCACTGGAG GGTGCCAAGGATTCACCCA

TCCGCCGTGCCGTGAAAGATACCCTTTCCAATCCACAGTCCCCTCAGCCATCACCTTACAACTCCCCCAAACCACAACACAAAGTCACACAGAGCTTCCT

GCCACCAGGCTGGGAGATGAGGATAGCCCCCAACGGCCGACCCTTCTTCATTGACCATAACACAAAGACTACAACCTGG - UNI7762 - GAAGATCC

ACGGTTGAAATTTCCAGTACACATGCGGTCAAAAGCATCTTTAAACCCCAATGACCTGGGCCCTCTTCCT CCTGGCTGGGAAGAGAGGATCCACTTGGA

TGGCCGCACGTTTTACATTGACCATA ATAGTAAAATTACCCAGTGGGAAGATCCAAGACTACAGAACCCAGCCATCACTGGTCCG GCTGTTCCGTACT

CCAGAGAGTTTAAGCAGAAATACGACTACTTTAGGAAGAAATTAAAGAAGCCT GCTGATATTCCAAACAGGTTTGAAATGAAACTTCACAGAAACAACA

TATTTGAAGAGTCCTATCGGAGGATCATGTCTGTAAAGAGACCTGACGTCCTAAAGGCTAGGCTGTGGATTGAGTTTGAATCAGAGAAAGGCCTGGACTA

TGGGGGCGTGGCCAGAGAATGGTTCTTCTTACTGTCCAAAGAGATGTTTAACCCCTACTATGGCCTCTTCGAGTACTCTGCCAC GGACAACTACACACT

TCAGATCAATCCCAACTCAGGCCTCTGTAATGAAGACCATTTGTCCTATTTCACCTTCATTGGAAGAGTTGCTGGCCTAGCGGTGTTTCATGGGAAACTC

TTAGATG GATTCTTCATTCGACCATTCTACAAGATGATGCTGGGGAAGCAGATAACGCTGAACGACATGGAGTCCGTG GACAGCGAGTACTACAACTC

TTTGAAGTGGATCTTAGAAAACGACCCCACGGAACTTGACCTCATGTTCTGCATAGACGAAGAGAACTTTGGGCAG ACATACCAAGTGGATCTGAAGCC

CAACGGGTCAGAAATAATGGTAACCAATGAGAACAAACGAGAATACATTGA CTTAGTCATCCAGTGGAGATTTGTGAACAGGGTCCAGAAGCAAATGAA

TGCCTTCTTGGAG - UNI3234 - GGATTTACAGAACTTCTTCCAATCGACTTGATTAAAATTTTTGATGAAAATGAGCTGGAG TTGCTGATGTGCG

GCCTTGGTGATGTCGACGTGAACGACTGGAGACAGCACTCTATTTACAAGAACGGCTACTGCCCCAACCACCCTGTCATCCAGTGGTTCTGGAAG GCCG

TGCTCCTGATGGATGCTGAGAAGCGCATCCGGTTACTACAGTTTGTCACAGGCACCTCCAGAGTACCCATGAATGGATTTGCCGAACTCTATG GTTCCA

ATGGTCCTCAGCTGTTTACAATAGAGCAATGGGGCAGTCCCGAAAAACTACCCAGAGCTCATACATG CTTTAATCGCCTTGATTTACCTCCATATGAAA

CCTTTGAAGATTTACGGGAGAAACTTCTCATGGCTGTGGAAAACGCTCAAGGCTTCGAAGGTGTGGATTAAGGAAGGCTCCAGCGTCCGGGGCACTGCCC

TTCCAGCAAGTTCCAAGCGCACTTTTGCATTTGCCGAGCAGACTTTTGCAGAGCCGGTGGCAGAAGCAGTGGCCTGGCCCGGCTCTGGAGCCCAGCTTGT

CTGGGCCCTGCCCAAGTTCCGCCAGGGAACCCAGCCCCAGCTCAAGTGCCGCCCCCTCACCGCCAATTCTCAACTGGTTGCCGTGTACACTGATTACATT

TCAGGAGGACGTGTTCTATTTATGTTGTGCCTCTGCAGGCAAAGCCCTTAATAAATATTTTGCATACTTTCTAATGACAATGAATGGAATTAATCACGCT

ACAGGTATAGTATTACAACTCATGTTTACTTTTTAAAATGATTTAGACTGATTTTCAGCTTTTATTTCATTACAATTAAAGATGTCTCATGT
Translation
MSLCEAPVHVGDKELKYFQIPQMLSQLSLLASHHSRGLEFSGGQ - UNI21138 - GESRILRVKVVSGIDLAKKDIFGAS - UNI27602 - - U

NI30027 - SDPYVKLSLYVADENRELALVQTKTIKK - UNI27602 - TLNPKWNEEFYFR VNPSNHRLLFEVFDENRL TRDDFLGQVDVPLSH

LP TEDPTMERPYTFKDFLLRPRS SHKSRVKGFLRLKMAYMPKNGGQDEENSEQRDDME HGWEVVDSNDSASQHQEELPPPPLPPGWEEKVDNLGRTY

YVNHNNRSTQWHRPSLM MDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEPEASEGGGEGPE PWETISEEMNMAGDSLSLALPPPPASPVSRTSPQE

LSEEVSRRLQITPDSNGEQFSSLI - UNI876 - QREPSSRLRSCSVTDTVAEQAHLPP PSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTW

TRPIMQ LAEDGASGSATNSNNHLVEPQIRRPRSLSSPTVTLSAPLE GAKDSPIRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNG

RPFFIDHNTKTTTW - UNI7762 - EDPRLKFPVHMRSKASLNPNDLGPLP PGWEERIHLDGRTFYIDHN NSKITQWEDPRLQNPAITGP AVPYS

REFKQKYDYFRKKLKKP ADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSAT TDNY

TLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDG GFFIRPFYKMMLGKQITLNDMESV DSEYYNSLKWILENDPTELDLMFCIDEENFGQ TYQ

VDLKPNGSEIMVTNENKREYID DLVIQWRFVNRVQKQMNAFLE - UNI3234 - GFTELLPIDLIKIFDENELE LLMCGLGDVDVNDWRQHSIYKN

GYCPNHPVIQWFWK AVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYG GSNGPQLFTIEQWGSPEKLPRAHTC CFNRLDLPPYETFEDLREKLLMAVE

NAQGFEGVD

For any suggestions or comments, please send an email to unitrap@crg.es