Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024642 (Tle4)
Chromosomal location
Chr 19: 14522562 - 14672473 (-)
Description
transducin-like enhancer of split 4, homolog of Drosophila E(spl) Gene [Source:MGI Symbol;Acc:MGI:104633]
RefSeq_peptide
NP_035730.2 
UniGene
Mm.397352 Mm.103638 Mm.470886 
MGI
MGI:104633 
Uniprot/SWISSPROT
Q62441 
Uniprot/SPTREMBL
Q6PDS9 Q80VE9 Q3UY41 Q80TG4 
Human Ortholog
ENSG00000106829 (TLE4)
Omim not available
UniTrap UNI21399
Vector Insertion
Chr 19: 14671345 - 14671857
Public Clones not available
Private Clones OST332204 (lexicon) OST215729 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25993
Vector Insertion
Chr 19: 14670144 - 14671246
Public Clones not available
Private Clones OST147981 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24860
Vector Insertion
Chr 19: 14668919 - 14670079
Public Clones not available
Private Clones OST203324 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13588
Vector Insertion
Chr 19: 14638942 - 14668873
Public Clones CMHD-GT_319A03-3 (cmhd) CMHD-GT_309B07-3 (cmhd)
Private Clones OST39259 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4643
Vector Insertion
Chr 19: 14619353 - 14638878
Public Clones AQ0591 (sanger)
Private Clones OST274642 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2543
Vector Insertion
Chr 19: 14592464 - 14619277
Public Clones AD0137 (sanger) XS0497 (sanger) (cmhd) CMHD-GT_539E10-5S (cmhd)
Private Clones OST6284 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25785
Vector Insertion
Chr 19: 14590866 - 14592261
Public Clones not available
Private Clones OST166473 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1623
Vector Insertion
Chr 19: 14542762 - 14590848
Public Clones (sanger) AK0456 (sanger) AZ0160 (sanger) CMHD-GT_495F9-3 (cmhd) CMHD-GT_493H3-3 (cmhd)
CMHD-GT_495H2-3 (cmhd) CMHD-GT_474C6-3 (cmhd)
Private Clones OST451138 (lexicon) OST314459 (lexicon) OST59267 (lexicon) OST59266 (lexicon)
OST44668 (lexicon) OST42945 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28809
Vector Insertion
Chr 19: 14541192 - 14541669
Public Clones not available
Private Clones OST19477 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8988
Vector Insertion
Chr 19: 14529481 - 14538798
Public Clones XF043 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087726
Sequence
CACGCATCAAG CGACGGTAACATCGCAGTGTGGGATCTGCACAACCAGACTCTGGTGAG GCAATTCCAGGGGCACACAGATGGAGCCAGCTGTATTGA

CATTTCTAATGATGGCACCAAGCTCTGGACAGGTGGTTTGGACAACACTGTGAGGTCCTGGGACCTGCGTGAAGGGCGGCAGCTGCAGCAACATGACTTC

ACCTCTCAG ATCTTTTCATTGGGCTATTGCCCAACTGGAGAGTGGCTTGCAGTGGGGATGGAGAATAGCAATGTGGAAGTATTGCATGTCACCAAACCA

GACAAATACCAGTTGCATCTTCATGAGAGCTGTGTGCTGTCACTCAAGTTTGCCCACTGTG GCAAATGGTTTGTAAGCACTGGAAAGGACAACCTTCTG

AATGCTTGGAGGACGCCTTATGGGGCCAGCATATTCCAG TCCAAAGAATCCTCATCGGTGCTTAGCTGTGACATCTCTGTGGATGACAAGTACATTGTC

ACTGGCTCTGGGGACAAGAAAGCTACGGTTTATGAAGTTATTTATTAAGGACAAATCTTCGTGCAAACTGGACTCCTCCTCATAGCACTTTGCGCTGTTG

TACTTTTCTGTTCACCCCTCTCCCATTCTAAAACCAAGGATTTCCAATACTCATTGCAGTTGTGGAGTTTAATCCCTTCCCATAGCCCCACTTCCTCCTT

GCTATTGAATTGTGAATACTCATTAAGAACCTGTGATACCAAATCTTCAGCTATCGTCTTGGAAGAACATGGAATACCTAACAGTGAATGGAATCTTTAA

TTATGTATTATATCTGTAATATATTTATTTTGTTTAAAGAAGGCTTTCTAACAATGACTGACTAAATAAAGCTGTCCGCTCCTGCATTGATAATGAAGGT

GCATTGTATTTGATGCTCCACCCCTCCCTTTTGGTGAGGGAGGGGAAAGGAAGGTTTAAAATAACTGATTTAAATGTCACTAAATGTAGACTATTGACTG

TATAGAGATGTGAAATGTATAATTACACACGGAAGCAATATGTTGCTGTGTTGTTATGAGGTTGTTTTGTTTTATTTTCTACTTATATTAAAAACATTTG

GAAATTTGGCTGTTTGAACAAGTAGAATATAACAGGCCAAGTACTATTCCTTTGAGTCTATTTGGGCAACTTTAACCAATATGTCTATAACTTTAGATTA

CATTCAACAAAAATAATTAGATGTTTTTCTTTTTTATTTTTTACTTGTTGACAAGTATCTTTGTAATATTTTTTAATTCCTTTTTTTATTGTATTATAGA

CAGATCAAAAATTAAATTGGGCCTCAAAGAGAGAACTTAATTTCTTCTAAATATTTTTGCCAAATTTCCTGGCAGAGGAAGCTGTGTGTCTCTGGGCAGT

TGTGATGCTGTGAGACATGGCAGGCTGTTTTGTGTCATGCTCTTTAGGAGCTGTAGGTACAGGAGGACTGCTTGCCTACCGCTGTGCAAAGCAAGTCTTT

CCCACACAAAGGCCAGCAGAGGAGGGTTTGCAGAGCCCACCCTCTGAAAGCCACAAAGAAGAGCCTCTCCCGGGATGGTGGCTTGCTTTATTTACCTCTG

GTTCTTTCCATGTCTTAGTTGGATGTCCCTGAAATGGACACAGGCTGTGCCATTGTGCCAGAAACATTGTGTTATCTTTTATGTTGTTGTTGTTGTTGCT

GTTAAAACTATAACATGTGACTCCTTTTTTATTATTATTTTTTGTTTGAATGCTTTAAAAAGATCTTTTAAGTCTGTGGATCTGCTGATGTACAGTGCCT

TTGCTGCTATGGATCAAAATCAAGAACTGTGTAGATAAACTTTATTGTATAAGTAGAAAAATCACTTAATTTCATACTAGAAATGGATGGATGCTGCAAG

CTGAAATGGACTGTCATTGACGTTCTTTGTGTGGTAGCAAAAAAAATGGTGTCTTAAGTGCTTAGTGTTTGATGTCATTAACAGTTTCATAAAACTCTAC

AGTGTAGAAAGATTTTGATACTAAACTGTGCATTGTACATAGTTCTAACGCATTGTGTTGGCCACCAGTACTTCTATGATGGTAGATTGTTTGTGCATTC

AGACTTTTAAGCATTAAACATAAATAACTTCT
Translation
HASS SDGNIAVWDLHNQTLVR RQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQ IFSLGYCPTGEWLAVGMENSNVEVLH

VTKPDKYQLHLHESCVLSLKFAHCG GKWFVSTGKDNLLNAWRTPYGASIFQ SKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
Transcript ENSMUST00000052011
Sequence
ACTCGTGTATTATTTTGAGGTGGTGTTCGCAGAGTTTGAAAGAGAATTTTAAAAAGCCGCAAGCGTTTCGCTCTTTTATTTTTATAATCCCCTTCAATTT

GGGGCTAAAAAAACAGGAAGGAAGAAAAGGAAATGAAATGTGGTAAAAGAAGCTAAAAGGTGCCTTTTAAAAGATCGTTGCTGTGAAGTGAAAAAAAATC

TCCAGAGAACCCCCAAGCGCCGCGAGACCTCTTCCGAACCAAAGGAGTTTGCGCTCGCTCTCAGGGAAGAAGCGACCATTCATTCCGAGGAATAGCAGCC

AATTAAAAGACAAATAAAAAAAGTTTGGAGTGGGGCGCGAGCAGGCGGGCGGCGCTCGGCGGGCGCGGGGCTCGGCGGGCGCAGGACGGACGGTGCCCGC

CGCCCTCAGTGACGCCCGCGGGGAATGCGGAGCCGGCCGCCCGCGCCCAGCCGCCGCGCCTGCCTGCCGCCCGCGTCACGCGAGACCCGCAGGCCCGGGA

CGCCGCCGCGGGGCCCTCGAAGCGGATGAGCCGCGCGCCTCTGCCTGGCGCAGCCAACTAAAGCGGCGTGGATGATTCGCGACCTGAGCAAGATGTACCC

GCAGACGCGCCACCCG - UNI21399 - GCACCGCATCAGCCTGCTCAACCCTTCAAATTTACAATTTCAGAATCCTGTGATCGGATTAAGGAAGAGT

TTCAGTTTTTACAGGCTCAATACCACAG - UNI25993 - TCTGAAGCTGGAATGTGAGAAGCTCGCCAGCGAGAAGACAGAGATGCAGCGGCATTAT

GTCATG - UNI24860 - TATTATGAAATGTCCTATGGGTTGAACATAGAAATGCACAAGCAG - UNI13588 - GCAGAGATTGTTAAACGACTA

AATGCTATCTGTGCACAGGTCATTCCTTTCCTGTCCCAAGAG - UNI4643 - CACCAGCAACAAGTGGTGCAGGCTGTGGAACGGGCCAAGCAGGTG

ACCATGGCAGAACTGAACGCCATCATTGGG - UNI2543 - CAACAACTCCAAGCTCAGCATTTATCACATGGACATGGTCTGCCTGTGCCTCTGACA

CCACACCCTTCAGGGCTTCAGCCCCCAGCCATCCCACCTATCGGTAGCAGTGCAGGACTTCTGGCCCTCTCCAGTGCACTAGGAGGTCAGTCTCACCTCC

CAATTAAGGATGAGAAGAAGCACCATGACAATGATCACCAAAGAG - UNI25785 - ACAGAGACTCCATCAAG - UNI1623 - AGCTCTTCCGT

ATCCCCATCAGCCAGTTTCCGGGGTTCTGAGAAACATAGGAACTCTACAGACTATTCCTCAGAGAGCAAAAAGCAGAAAACAGAAGAAAAAGAAATTGCA

GCTCGCTAT GACAGTGATGGTGAGAAGAGTGATGACAACTTGGTAGTTGATGTGTCCAATGAG - UNI28809 - GATCCATCTTCCCCCCGAGGAA

GCCCAGCACATTCCCCAAGGGAGAATGGCCTGGACAAGACACGACTCCTCAAGAAAGATGCCCCCATCAGCCCCGCTTCTGTTGCATCTTCCAGCAGTAC

TCCTTCCTCCAAATCCAAAGAGCTTAGCCTT AATGAAAAGTCTACTACTCCTGTTTCAAAGTCCAATACCCCTACTCCACGAACTGATGCACCTACCCC

TGGCAGTAATTCTACTCCTGGACTGAGGCCTGTACCTGGAAAGCCACCAGGTGTGGACCCCTTAG CATCAAGCCTGAGGACCCCGATGGCTGTACCTTG

TCCATATCCAACCCCCTTTGGGATCGTGCCCCATGCTGGGATGAACGGAGAGCTGACCAGCCCCGGAGCCGCCTATGCTGGGCTACACAACATCTCCCCC

CAGATGAGTGCAGCTGCTGCTGCAGCTGCGGCAGCAGCAGCCTATGGAAGATCACCTGTG GTGGGATTTGATCCACACCATCACATGCGAGTGCCAGCA

ATACCTCCAAATCTAACAGGCATTCCAGGAGGAAAACC - UNI8988 - AGCATACTCCTTTCACGTCAGTGCCGATGGCCAGATGCAGCCTGTCCCT

TTCCCCCCTGATGCCCTCATTGGACCAGGGATCCCCCGACACGCTCGACAGATCAACACCCTCAACCATGGGGAGGTGGTGTGTGCAGTGACCATCAGCA

ACCCCACAAGGCACGTGTACACAGGTGGCAAGGGCTGTGTTAAGGTCTGGGACATCAGCCACCCTGGCAACAAGAGCCCAGTCTCTCAGCTGGACTGTCT

G AACAGGGATAACTACATCCGTTCCTGCAGATTGCTCCCTGATGGTCGCACCTTAATTGTTGGAGGGGAAGCCAGCACACTGTCCATCTGGGACCTGGC

AGCTCCAACTCCACGCATCAAGGCAGAGCTGACATCCTCAGCCCCTGCCTGCTATGCTCTGGCCATCAGCCCCGACTCCAAGGTCTGCTTCTCATGCTGC

AGCGACGGTAACATCGCAGTGTGGGATCTGCACAACCAGACTCTGGTGAG GCAATTCCAGGGGCACACAGATGGAGCCAGCTGTATTGACATTTCTAAT

GATGGCACCAAGCTCTGGACAGGTGGTTTGGACAACACTGTGAGGTCCTGGGACCTGCGTGAAGGGCGGCAGCTGCAGCAACATGACTTCACCTCTCAG 

ATCTTTTCATTGGGCTATTGCCCAACTGGAGAGTGGCTTGCAGTGGGGATGGAGAATAGCAATGTGGAAGTATTGCATGTCACCAAACCAGACAAATACC

AGTTGCATCTTCATGAGAGCTGTGTGCTGTCACTCAAGTTTGCCCACTGTG GCAAATGGTTTGTAAGCACTGGAAAGGACAACCTTCTGAATGCTTGGA

GGACGCCTTATGGGGCCAGCATATTCCAG TCCAAAGAATCCTCATCGGTGCTTAGCTGTGACATCTCTGTGGATGACAAGTACATTGTCACTGGCTCTG

GGGACAAGAAAGCTACGGTTTATGAAGTTATTTATTAAGGACAAATCTTCGTGCAAACTGGACTCCTCCTCATAGCACTTTGCGCTGTTGTACTTTTCTG

TTCACCCCTCTCCCATTCTAAAACCAAGGATTTCCAATACTCATTGCAGTTGTGGAGTTTAATCCCTTCCCATAGCCCCACTTCCTCCTTGCTATTGAAT

TGTGAATACTCATTAAGAACCTGTGATACCAAATCTTCAGCTATCGTCTTGGAAGAACATGGAATACCTAACAGTGAATGGAATCTTTAATTATGTATTA

TATCTGTAATATATTTATTTTGTTTAAAGAAGGCTTTCTAACAATGACTGACTAAATAAAGCTGTCCGCTCCTGCATTGATAATGAAGGTGCATTGTATT

TGATGCTCCACCCCTCCCTTTTGGTGAGGGAGGGGAAAGGAAGGTTTAAAATAACTGATTTAAATGTCACTAAATGTAGACTATTGACTGTATAGAGATG

TGAAATGTATAATTACACACGGAAGCAATATGTTGCTGTGTTGTTATGAGGTTGTTTTGTTTTATTTTCTACTTATATTAAAAACATTTGGAAATTTGGC

TGTTTGAACAAGTAGAATATAACAGGCCAAGTACTATTCCTTTGAGTCTATTTGGGCAACTTTAACCAATATGTCTATAACTTTAGATTACATTCAACAA

AAATAATTAGATGTTTTTCTTTTTTATTTTTTACTTGTTGACAAGTATCTTTGTAATATTTTTTAATTCCTTTTTTTATTGTATTATAGACAGATCAAAA

ATTAAATTGGGCCTCAAAGAGAGAACTTAATTTCTTCTAAATATTTTTGCCAAATTTCCTGGCAGAGGAAGCTGTGTGTCTCTGGGCAGTTGTGATGCTG

TGAGACATGGCAGGCTGTTTTGTGTCATGCTCTTTAGGAGCTGTAGGTACAGGAGGACTGCTTGCCTACCGCTGTGCAAAGCAAGTCTTTCCCACACAAA

GGCCAGCAGAGGAGGGTTTGCAGAGCCCACCCTCTGAAAGCCACAAAGAAGAGCCTCTCCCGGGATGGTGGCTTGCTTTATTTACCTCTGGTTCTTTCCA

TGTCTTAGTTGGATGTCCCTGAAATGGACACAGGCTGTGCCATTGTGCCAGAAACATTGTGTTATCTTTTATGTTGTTGTTGTTGTTGCTGTTAAAACTA

TAACATGTGACTCCTTTTTTATTATTATTTTTTGTTTGAATGCTTTAAAAAGATCTTTTAAGTCTGTGGATCTGCTGATGTACAGTGCCTTTGCTGCTAT

GGATCAAAATCAAGAACTGTGTAGATAAACTTTATTGTATAAGTAGAAAAATCACTTAATTTCATACTAGAAATGGATGGATGCTGCAAGCTGAAATGGA

CTGTCATTGACGTTCTTTGTGTGGTAGCAAAAAAAATGGTGTCTTAAGTGCTTAGTGTTTGATGTCATTAACAGTTTCATAAAACTCTACAGTGTAGAAA

GATTTTGATACTAAACTGTGCATTGTACATAGTTCTAACGCATTGTGTTGGCCACCAGTACTTCTATGATGGTAGATTGTTTGTGCATTCAGACTTTTAA

GCATTAAACATAAATAACTTCTAGAATGATTATTTTCTAATTATTTTTGCTAATTGCTTTGTCTATGCCACTCCCTATATTAAAATCACTAGTTATATTC

Translation
MIRDLSKMYPQTRHP - UNI21399 - APHQPAQPFKFTISESCDRIKEEFQFLQAQYHS - UNI25993 - SLKLECEKLASEKTEMQRHYVM -

 UNI24860 - YYEMSYGLNIEMHKQ - UNI13588 - AEIVKRLNAICAQVIPFLSQE - UNI4643 - HQQQVVQAVERAKQVTMAELNAIIG

 - UNI2543 - QQLQAQHLSHGHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGGQSHLPIKDEKKHHDNDHQRD - UNI25785 - DRDSI

K - UNI1623 - SSSVSPSASFRGSEKHRNSTDYSSESKKQKTEEKEIAARY DSDGEKSDDNLVVDVSNE - UNI28809 - DPSSPRGSPAHSP

RENGLDKTRLLKKDAPISPASVASSSSTPSSKSKELSL NEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLA ASSLRTPMAVPCPYP

TPFGIVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSPV VGFDPHHHMRVPAIPPNLTGIPGGKP - UNI8988 - PAYSFHVSAD

GQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCL NRDNYIRSCRLLPDGRTLIVGGEAS

TLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVR RQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQ

LQQHDFTSQ IFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLHESCVLSLKFAHCG GKWFVSTGKDNLLNAWRTPYGASIFQ SKESSSVLSCD

ISVDDKYIVTGSGDKKATVYEVIY

For any suggestions or comments, please send an email to unitrap@crg.es