Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024694 (Keg1)
Chromosomal location
Chr 19: 12770283 - 12794384 (+)
Description
kidney expressed gene 1 Gene [Source:MGI (curated);Acc:Keg1-001]
RefSeq_dna
NM_029550 
RefSeq_peptide
NP_083826.1 
MGI
MGI:1928492 
Uniprot/SWISSPROT
Q9DCY0 
Human Ortholog
not available
Omim not available
UniTrap UNI31346
Vector Insertion
Chr 19: 12770332 - 12784086
Public Clones IST14099G12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31373
Vector Insertion
Chr 19: 12785580 - 12788996
Public Clones IST13904D10 (tigm) IST13857A5 (tigm) IST14922E7 (tigm) IST14384F11 (tigm)
IST13821D10 (tigm) IST13801F1 (tigm) IST13223H10 (tigm) IST10763G11 (tigm)
IST12003D7 (tigm) IST10997C9 (tigm) IST13857G7 (tigm) IST15085B10 (tigm)
IST13857A4 (tigm) IST10016G8 (tigm) IST11703A1 (tigm) IST11274E11 (tigm)
IST14092H1 (tigm) IST13821F1 (tigm) IST14043A5 (tigm) IST14166F9 (tigm)
IST13857F8 (tigm) IST14023F1 (tigm) IST11914B6 (tigm) IST15034B5 (tigm)
IST11413G7 (tigm) IST13857D7 (tigm) IST13799D11 (tigm) IST14366A11 (tigm)
IST13857B6 (tigm) IST13258H3 (tigm) IST10220F3 (tigm) IST12147C10 (tigm)
IST13064A12 (tigm) IST13857A8 (tigm) IST13821E10 (tigm) IST13799A2 (tigm)
IST13857D5 (tigm) IST12108C2 (tigm) IST13857B8 (tigm) IST13799B2 (tigm)
IST13857C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025598
Sequence
GCTTGTTCTTTGTTCTGAGGAAGCTCTCTGTGTGGATACGGAGTTATAG - UNI31346 - GTATCAGAAGAGATGTTCTGCTTACAGAGTTCCCAAG

CACTGCAGGTTCTGGAGAATTCCCTAAGGAAGCACCTCCCTGAGTCCTTAAAG GTTTATGGGACTGTCTTCCACATCAATCAGGGAAACCCATTCAAGC

TCAAGACTTTGGTGGACAAATGGCCTGATTTTAATACTGTTGTTATTCGACCCCAGGAAGAG - UNI31373 - GACATGACAGATGACCTTGACCAC

TACAACAACACTTATCTAGTGTATTCAAAGGATCCCAAGCACTGTCAGGAATTCCTTGGCTCATCAGAAGTTATTAACTGGAAACAACATTTGCAGATTC

AAA GTTCACAGTCAGACCTGGGCAAAGTGATAGAAAGTCTTGGAGCCACTAACTTGGGCAAGGTCAAGCATAAGCAGTGCTTTCTCTATATGGTATGCC

AAACAGCAAAGAAACTGGCTCCTTCCTTGATGGATGCAAAGAACTTAGTAGTCAGCCGTAACAAGCTCACGCCTCT TGACCAGCAGTTATTCAAATTTG

CCTCACTGGATGTTACACATGCTGCACTGGTGAATAGCCTCTGGCATTTTGGTGGCAATGAGAAGAGCCAGAAGTTCATTGAACGCTGTATCTTTACCTT

CCCCAGCTTCTGTATTATGGGGCCTGAGGGGACCCCTGTGTCCTGGACCCTGATGGACCACACTGGAGAACTGAGAATGGGAGGCACCTTGCCTAAGTAC

CGGCGCCAGAGTCTCATTTACCATGTTGCTTCCCAGCAGATTCAGACACTAGAAAAGCTTGGCTTTCCCATGTATGCACATGTGGATAAGGCTAACTTCA

CTGTTCAGAGAATGGTTGGCTTGCTGGGGCAAATCCTCTTGCCTTGTACCTGGAACCAGTGGAACTGTGTACCGCTATAAAGCTAGAAAAGGGTGAGAAG

GGGCCTGCGCTTGTAGACGGAGAAATGGCTGAGAGAACAGAGAGAAGTGAACTGTCATTAGGATGGTGTGAGTTTCTAGAGAGCAGAGGTGCACCTCGCT

GAGCTTCACACCCTGTTTCCGCGCGCTCACCTTGTTCATGCTCTTAACTCCATTCTTTGGCATGCAGAAGGCCACCTTCTCCTCCTCCACCCCTGTTACA

GCTCCCACATTCTCAGGATTCCTCTAACACATTTGGCTAAATTGTACTCTTTTCTATTTGTTTTGCTGGCTCATTGATCCATGCCCATTAGTCAGTAGTT

TGTGACCTATCCTGCACTCCCCTTGCACACAAGGCATACCTCCTCTGACTTTCTGTAGTTTTGCTTTTATGGGCTGGAGAAGTAGCCCGTCATCTAAAAA

GATGTTTTCAAAAATGATTCTTTCTCACGCCACTCACTAGGCAGTATATTGTTAATATGTAAAAACTACCATATATGCAAACACAGATGCACAATATGTG

TGGTGCAACTGTAAGAATTATTAGGAAAGAGACAAGTAAATGTGCTTGCAGCCAAGCCTGGAAACCTGAATGTGATTCCTGGGACCCATTTGTAAAAGGA

GAGCATCAACTCCATTACCTTGCCCTCTGACTGCCACAGGTATGGAGCAGTATTTGCACACACAAATAAATAAATGTATTATTTCAAAAGTT
Translation
 - UNI31346 - MFCLQSSQALQVLENSLRKHLPESLK VYGTVFHINQGNPFKLKTLVDKWPDFNTVVIRPQEE - UNI31373 - DMTDDLDHY

NNTYLVYSKDPKHCQEFLGSSEVINWKQHLQIQS SSQSDLGKVIESLGATNLGKVKHKQCFLYMVCQTAKKLAPSLMDAKNLVVSRNKLTPL LDQQLF

KFASLDVTHAALVNSLWHFGGNEKSQKFIERCIFTFPSFCIMGPEGTPVSWTLMDHTGELRMGGTLPKYRRQSLIYHVASQQIQTLEKLGFPMYAHVDKA

NFTVQRMVGLLGQILLPCTWNQWNCVPL

For any suggestions or comments, please send an email to unitrap@crg.es