Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024754 (Tmem2)
Chromosomal location
Chr 19: 21852832 - 21932817 (+)
Description
transmembrane protein 2 Gene [Source:MGI Symbol;Acc:MGI:1890373]
RefSeq_dna
NM_001033759 NM_031997 
RefSeq_peptide
NP_001028931.1 NP_114386.3 
UniGene
Mm.329776 
MGI
MGI:1890373 
Uniprot/SWISSPROT
Q5FWI3 
Uniprot/SPTREMBL
Q8BS93 
Human Ortholog
ENSG00000135048 (TMEM2)
Omim not available
UniTrap UNI37695
Vector Insertion
Chr 19: 21853277 - 21854660
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14461
Vector Insertion
Chr 19: 21854743 - 21867127
Public Clones (sanger) E066E08 (ggtc) D111E08 (ggtc) 3SE223G07 (ggtc) E051G08 (ggtc)
D104G03 (ggtc) E021C12 (ggtc) D109G09 (ggtc) E036H05 (ggtc) E091F03 (ggtc)
D170A04 (ggtc) 5SE223G07 (ggtc) D106F03 (ggtc) FHCRC-GT-S11-9E1 (fhcrc) PST4792-NR (escells)
IST14249E1 (tigm) IST14468F6 (tigm) IST14507B2 (tigm)
Private Clones OST321414 (lexicon) OST280676 (lexicon) OST237240 (lexicon) OST225530 (lexicon)
OST195197 (lexicon) OST32702 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24748
Vector Insertion
Chr 19: 21867471 - 21871816
Public Clones (sanger)
Private Clones OST208020 (lexicon) OST56998 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9147
Vector Insertion
Chr 19: 21882038 - 21883758
Public Clones RST399 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36628
Vector Insertion
Chr 19: 21892502 - 21898277
Public Clones IST12513A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025663
Sequence
CTCTCGGCCCAGCCGAGCCGGCGCTTGTGTGGCCGGAGGCTGATTAGAGGGACCCTAGCGAGCCGCGGCGCCCGCCGAACCGGGGACCTGCGCGGCTCGG

GAACGCGCCCTGCCTGCCGCTATTGTCTCGGAGCCGCACAGGCTCGCGCCGCCCGGACGGCGATTCCCCTCCTCTTCCTCCGGGAGGGAAGGATCCAAGA

GCGCCAAGCCGGGCTGGCTGGAGGAGGTGGCCGCGAAGGCGGAGGGAGGAGCGTTACTCCCCGGCCCCGACTGCTTCTCCTCCGGCGTAGGTTGCCGCTG

AATTCAGAGCGGCAGCGGGACGCGGGTTCCTGGCCATGGAGAGGAGATCTGCACGCGGGGACTCCAGGAGCTCTGCTCCCGCTCCTGCTCCTCTGGCCAT

CGCGTAGACACCTGAGTAGACCGACGCCAGGAGGGGGAGGGGAAG - UNI14461 - TGACAGGGTATCATGTATGCCGCTGGTTCCAGGGGCCACTC

CCCTGCTTTCCTGCAACCTCAAAACGGAAACGGCCACCGCTCACCTGGTTATGTTCCCGGGAAGGTGGTTCCCTTACGTCCCGCGCCTCCTCCAAAGAAC

CACGCCTCCGCCAAACTGACCTCCAGGAGCCAAGACGCCCCAGCGACCTTTGCTTTCTCCCCCGAGGAGCAGCGGACTCCGAGCGAGAGCCGAAAGCGGA

AGAGGCACAAGAACACCTTCATCTGCTTCGCCATAACCAGCTTCTCGTTCTTTGTGGCGCTTGCGGTCATTTTGGGAATATCCTCAAAATACGCTCCAGA

TG - UNI24748 - AGAATTGTCCAGATCAAAACCCTCGTCTCAGGAACTGGGATCCAGGACAAGATTCTGCGAAGCACATTGTTATCAAGGAGGGGG

ATTTGTTCCGCCTGACCTCAGATGCAACAGTGGACTCTATAGTCATTCAGGATGGAG GACTGCTTGTGTTTGGGGATGATAAAGATGGATCCAAGAATA

TAACTTTGAGGACTCGATACATCCTGATCCAGGATGGTGGGGCGCTTCATATTGGAGCAGAAAAATGCCGCTATAGATCCAAAGCGACAATTACCTTGTA

TGGCAAGTCAGATGAACGTGAAAGTATGCCAATATTTGGCAAGAAGTTTATTGGCGTGGAGGCTGGCGGGACACTGGAGTTACACGGGGCACAGAGGACA

TCATGGACGATGCTGGCGAGGACTCTGCATTCTTCAGGCTTGCCCTTTGGGTCTTATGCCTTCGAGAAGGACTTTTCCCGGGGCCTTAATGTGAGGGTCA

TTGATCAAGACACAGCCAGAGTTTTAGAAAACGAGAAGTTCGATACCCACGAGTACCACAATGAGAGCAGGAGGCTGCAGGAGTTTTTGAGAGCTCAGGA

GCCCGGCCGGATTGTGGCTATTGCTGTTGGAGACTCAGCAGTCAAGAGCCTGTTACAGGGAACAATCCAGATGATCCAGGATCGGTTGGGGAGTAAACTG

ATCCAAGGTCTGGGCTACAG GCAAGCTTGGGCCTTAGTTGGTGTCATCGATGGTGGAAGTTCTTCCTGCAATGAATCTGTGAGAAACTATGAAAACCAT

AGCACTGGGGGGAAGGCCCTGGCTCAAGGAGAATTCTACACCCTGGACGGTCAGAAGTTCTCTGTGACAGCCTACAGTGAATGGAGTCAAG GAATCTCC

CTCTCAGGCTTCCGGGTGGACATTGCGGATGGAGTGAAGCTTCACCTGTTGGACGACGTCAGCACTTGGGAAGCTGGAGACCGAATTGTGGTGGCCAGCA

CCGACTATTCCATGTACCAAGCAGAGGAGCTAACTCTTCTCCGCTGCCCCGAGTGCAGCCGTTCTCAGGTCAAAGTCAAAG - UNI9147 - AGATCC

CCCAGTACCTGCACGTCGGTGAGATCATAGACGGGATAGACATGAGAGCTGAGGTTGGACTTCTCACCCGCAACATTGTGATCCAAGGAGAGATGGAGGA

TTCATGCTATGCAGAAAATCACTGCCAGTTCTTCGATTATGACACCTTTGGGGGACACGTCATG ATAGAGAAGAATTTTACTTCAGTCCATCTTTCTTA

TGTGGAATTGAAACACATGGGCCAGCAGCATATGGGCCGGTATCCTGTGCATTTTCACCTGTGTGGAGATGTAGATTCTAAAGGAGGGTACAGCCAGCCA

GCGTCTGTGGATGGCCTGTCTGTTCATCACAGCTTTTCAAGGTGCATCACCGTGCACGGGACCAGTGGCTTGCTA ATCAAAGACACCATTGGCTTCGAC

ACACTAGGTCATTGCTTCTTTTTGGAAGATGGTGTTGAACAGCGAAATATTTTGTATCATAACTTGGGGCTTCTTACCAAGCCGGGCACTCTCCTCCCAA

CGGACAGGAACAGCTCCATGTGCACCGTCATGCGTGATGGAGTGTTTGGAAACTACGTCCCTGTGCCTACCACAGACTGCAT GGCTGTTTCAACTTTCT

GGATTGCCCACCCCAACAACCACCTGATCAATAACGCAGCTGCAGGCTCACAG GATGCTGGAATATGGTATTTATTCCACAAGGAACCAACTGGGGAGT

CCAGTGGGCTGCAGCTCCTGGAGAAGCCAGAACTCACTCCGCTGGGGATATTTTATAACAACAGGGTTCATTCAAATTTTAAG GCTGGTTTATTTGTGG

ACAAAGGTGTCAAAACGACCAACGCCAGTGCATCTGACCCAAGGGAGTACCTCTGCCTGGATAACAGTGCAAG - UNI36628 - GTTTCGGCCCCAT

CAGGATGCAGACCCTGAGAAGCCACGCGTTGCAGCCATCATCGACAGGCTCATTGCTTTTAAGAACAATGACAACGGAGCCTGGGTCAGAGGAGGAGATA

TTATTGTTCAGAATTCAGC ATTTGCAGATAACGGAAAGGGGCTGACCTTTGCCAG TGATGGGAGCTTCCCAAGCGATGAAGGGTCCAGTCAGGAGGTG

ACAGAGTCCCTCTTTGTCGGGGAGAGTAGGAATTACGGCTTTCAAGGTGGCCAAAACAAGTACATGGGCACAGGGGGAATCGATCAGAAGCCTCGGACGC

TACCCAGGAACAG GACATTCCCAATCCGAGGCTTTCAGATTTACGATGGGCCTATTCATCTCACAAAGAGTACTTTCAAAAAGTATGTGCCAACTCCAG

ACAGGTACAGCAGTGCAATTGGCTTCCTCATGAAGAATTCCTGGCAGACAACACCCAGGAATAACGTTTCCCTTGTGAAGTTTGGTCCACAG GTCTCTC

TGAACGTCTTCTTTGGAAAGCCTGGCCCCTGGTTTGAGGATTGTGAGCTGGACGGCGATAAGAACTCCATCTTCCATGACATTGATGGCTCTGTGACAGG

ATACAAGGACACCTATGTGGGAAGGATGGACAACTACCTGATCCGCCATCCAAACTGTGTCAATGTTACTAAGTGGAATGCAGTGATCTGTAGCGGGACC

TACGCCCAG GTGTATGTTCAGACCTGGAACACTCCGAATCTTAGCATGATCATCACACGGGATGAATACCCATCCCACCCAATGGTGCTTCGGGGTATC

AACCAGAGGGCCATCTCTCCACAGTACCAGCCTGTTGTCATGCTGGAGAAGGGCTACACCATCCACTGGAATGGTCCAGCGCCACGAACCACTTTCTTGT

ACCTCGTGAACTTCAACAA GGATGACTGGATCCGGGTTGGCCTCTGTTACCCAGCCAACACGAGCTTTCAGGTTACCGTTGGCTTTCTGCAGCGGCAGA

ACGGCTCATTATCTAGAATTGAGGACTATGAGCCTGCGCGGTCGATGGAGGAACTGCAGAAGAAGCCGTCTGAGAGAAAATTCTATTTTGACTCTGGCAC

AGG GTTATTGTTTCTGTATCTCAGAGCCCACAGCCACAGAGATGGCCACAGTTACTGTTCATCTCAGGGATGTGAAAGAGTCAAGATTCAGGCAGCAAC

AGACTCCAAAGATATCAGTAACTGCATGGCCAAAGCGTACCCGCAGTATTACAAGAAGCCCTCGGCGGTCAAGCGCATGCCGGCCATGCTCACGGGGCTC

TGTCAAGGCTGTGGAACCCACCAG ATGGTGTTTACCAGTGACCCTCACAAAAGCTACCTCCCTGTACGATTCCAGTCACCTGGGAAAGCAGAAATTCAG

CGAGGAGATCCATCCATTATTTCC GTCAATGGTACTGACTTTACCTTCCGGAGTGCGGGTGCCCTCCTCCTCATTGTGGATGCCTGCAGTGTGCCCTTC

CGGGTGAAGGAAAAGCGGATGTTCCTTTCTGCAGACGTCAGTCACATGGAAGAATATTTCAAGGCTAGCATCCCCCCAAG GTCAATCGTTCTGTTGAGC

ACAAGAGGAGAAATTAAGCAGCTGAATATCTCGGATTCATTAGCAGTTCTGGGACTGGCCAAGCCAGCACATCTGTACAGCAAAG GTAGTGTCGTATTT

TTGGGATTCAGCGGAAACTTCGCACCGTCATGGACGAAGCTGTTCACCAGTCCCGATGAGCAGGGCCTCGGAGTGCTTGAGCAGTTTCTCCCGTTGCAGA

TGGAGGAATATGGGTGCTCCCGGACCGGCAGTGTCCACAGAAGAGACCTTGACCTGTTACAGCAGGCTTTGAAAGTGCTTTAGAGACTTGGTTGTAATTT

AAGTGCTGGGAAAGAAAAAAAAAATGTGAACTAACTTATTTAATTTATGGCATTTTAAGACAACACTGTTAACCCGATGGAACCATTTTCCTGTTTGATA

GAAAAGGGAGAGAAGGAATCCAAGCAGTTACCTGAGTGTCAGCTTGCAGGCCTTGGCACTGTGCAGGTGGTAGAGCCCTTTTGTCTTCCTGAGGCTGCTG

CGTTCAGAGAGCAGTTGGTCTCGTGGCCCTTGCTTTGACAAGCACATCGGGGGTGCTTTGCTTTTTGTATAGTGGGGTGCAGGGAGTCCAAGGGCTCCTT

GAACTTGCTCCTTCGAGGACTGGCTGCTCTAGCATTTCAGATACTTGAAGTCCAATGCTCAGTCCTGCGCTAACTCCAGTCGCTGCCCTGTTCAGTGATG

TCTGGGGCTCATTTCTGTACAGCCCACGAGGGTTTTATGTGATGCTAGATATGGTTTTAAGTGGCAACTCAGGCCCAGCACATGTCCTTTTTGCCTGGTC

ATGTGCTCTTTTTATTCACTTGTATACTGATTACTTTTGAGGGTTCACCTTTCAAAGAGGGAACCTTATTGGGACAAAAGGGCTTTTGAAATTTTTTAGA

TCTGTAACCATTGAGGAAAAAAAAAGAAAGAAAGAAACAACAACATAAACCTATTACTTGCATCCAGGTGGAACTTTTTCTGCAGCTTTAATCCTTAACC

TGTCTTGACCTTTAAAACGCAGAGCGGAACTGAATTAATTTTCTTTAAAAGCAGCAAGCCACTTCCTAAACTGTAAAACTCTTGTCATTTGAACTTGCAA

AAGAAAGCCAGGTGTGGTGGTGCACGCCTTTGATCACAGCACTCCAGGAGCAGGTGGATCTCTGAGAGTTTGAGGCTAGCCTGGTCTACGTAGTGATCCA

GGACAGCCAGGGCTACGTAGAGAAACCCTGTCTCAAAAGAAACAAAACAAAACAAAACAAAACAAAATCACTCTGTCAACAAAAGCTAACTTGCAAAAGG

GAAACCTGTCCTTGGTTTTGGTCTTGTACCTGTGCTTTGTTGTCTTGTTGTGTGGATTTTTTTTTTTTCCAAGCGGCTCTGCTCATTGTCCTACCAGAAA

ATCCCAGAGAGTTTCCCGCTTGCTCCTCCATAAATATTGTATTCAAGGAAAGAAAGGAGATGCCTTCTTAGGGTGGAATCATGGAGGCAATGGACATGAT

CTTCTTTGTAGCCTTTAAAAGAGGGAGTCTCTTAGTGAATGTAGCTTTCAAAGACAAGAAGAAAGGACTCTGGGTCTCCCAGTGCTGCTTCTACTGGCCC

TTTCTTCAGCCAGTGGGGACACATGTGGCAAAGGATGCTGGCTCTGCAGCCAAGAGGGAAGATGGCATCAGAATGCTGCTGTGCTGCCCAAAGGCGGGTG

GCTGAATAGCCAGGCTGACGGTAGCAATTGAGTGCAGAAAAGTTCATCTTCCTCCGTGGAGGGCCGAGGCTGATGCCTGTATGTTGTGTCCAGGAGACAT

TCTAGGACAGCTCTGTGACTTGTGTAACTTTACAGAACATGCTACCTCAAAGTGCTGTGACAAACCATTTGGACTGTAGTGCTCACAGGATGGGCACGTG

TCTTAATCAAAGTTTGGTTACTTGTTTATCCGGGTTTTTTGGATGTGGGGTTTTTTGTTTGTATTTTTTTTTCTTTTTCTTTCATTCTTTTTTTTTTTCT

TTTTTTTTTGTACAGTGAGATCTTACCTATTAAATATATTTAGTGGGTCATGGTTCCTGAAGGTGAGTGAATTGATTGTGTGTGCAGATGTGTGTGTGTT

ATGACTTAAATATATTTGTTTTGTGCTGTTTTAGAGTTCCTTTTTTATATATATTTGGAGAAAGTATGCAAGTTTCAAGGCACTCAGTGTTTCTGATTTT

TATGTACTAATAATTAGGGCCTAAGTTAAATAAATAAAAACGTGTGTGCATGTATTTTA
Translation
 - UNI14461 - MYAAGSRGHSPAFLQPQNGNGHRSPGYVPGKVVPLRPAPPPKNHASAKLTSRSQDAPATFAFSPEEQRTPSESRKRKRHKNTFICF

AITSFSFFVALAVILGISSKYAPDE - UNI24748 - ENCPDQNPRLRNWDPGQDSAKHIVIKEGDLFRLTSDATVDSIVIQDGG GLLVFGDDKDGS

KNITLRTRYILIQDGGALHIGAEKCRYRSKATITLYGKSDERESMPIFGKKFIGVEAGGTLELHGAQRTSWTMLARTLHSSGLPFGSYAFEKDFSRGLNV

RVIDQDTARVLENEKFDTHEYHNESRRLQEFLRAQEPGRIVAIAVGDSAVKSLLQGTIQMIQDRLGSKLIQGLGYR RQAWALVGVIDGGSSSCNESVRN

YENHSTGGKALAQGEFYTLDGQKFSVTAYSEWSQG GISLSGFRVDIADGVKLHLLDDVSTWEAGDRIVVASTDYSMYQAEELTLLRCPECSRSQVKVKE

 - UNI9147 - EIPQYLHVGEIIDGIDMRAEVGLLTRNIVIQGEMEDSCYAENHCQFFDYDTFGGHVM IEKNFTSVHLSYVELKHMGQQHMGRYPVH

FHLCGDVDSKGGYSQPASVDGLSVHHSFSRCITVHGTSGLL IKDTIGFDTLGHCFFLEDGVEQRNILYHNLGLLTKPGTLLPTDRNSSMCTVMRDGVFG

NYVPVPTTDCM MAVSTFWIAHPNNHLINNAAAGSQ DAGIWYLFHKEPTGESSGLQLLEKPELTPLGIFYNNRVHSNFK AGLFVDKGVKTTNASASDP

REYLCLDNSAR - UNI36628 - RFRPHQDADPEKPRVAAIIDRLIAFKNNDNGAWVRGGDIIVQNSA AFADNGKGLTFAS SDGSFPSDEGSSQEV

TESLFVGESRNYGFQGGQNKYMGTGGIDQKPRTLPRNR RTFPIRGFQIYDGPIHLTKSTFKKYVPTPDRYSSAIGFLMKNSWQTTPRNNVSLVKFGPQ 

VSLNVFFGKPGPWFEDCELDGDKNSIFHDIDGSVTGYKDTYVGRMDNYLIRHPNCVNVTKWNAVICSGTYAQ VYVQTWNTPNLSMIITRDEYPSHPMVL

RGINQRAISPQYQPVVMLEKGYTIHWNGPAPRTTFLYLVNFNK KDDWIRVGLCYPANTSFQVTVGFLQRQNGSLSRIEDYEPARSMEELQKKPSERKFY

FDSGTG GLLFLYLRAHSHRDGHSYCSSQGCERVKIQAATDSKDISNCMAKAYPQYYKKPSAVKRMPAMLTGLCQGCGTHQ MVFTSDPHKSYLPVRFQS

PGKAEIQRGDPSIIS VNGTDFTFRSAGALLLIVDACSVPFRVKEKRMFLSADVSHMEEYFKASIPPR RSIVLLSTRGEIKQLNISDSLAVLGLAKPAH

LYSKG GSVVFLGFSGNFAPSWTKLFTSPDEQGLGVLEQFLPLQMEEYGCSRTGSVHRRDLDLLQQALKVL
Transcript ENSMUST00000096194
Sequence
CTCTCGGCCCAGCCGAGCCGGCGCTTGTGTGGCCGGAGGCTGATTAGAGGGACCCTAGCGAGCCGCGGCGCCCGCCGAACCGGGGACCTGCGCGGCTCGG

GAACGCGCCCTGCCTGCCGCTATTGTCTCGGAGCCGCACAGGCTCGCGCCGCCCGGACGGCGATTCCCCTCCTCTTCCTCCGGGAGGGAAGGATCCAAGA

GCGCCAAGCCGGGCTGGCTGGAGGAGGTGGCCGCGAAGGCGGAGGGAGGAGCGTTACTCCCCGGCCCCGACTGCTTCTCCTCCGGCGTAGGTTGCCGCTG

AATTCAGAGCGGCAGCGGGACGCGGGTTCCTGGCCATGGAGAGGAGATCTGCACGCGGGGACTCCAGGAGCTCTGCTCCCGCTCCTGCTCCTCTGGCCAT

CGCGTAGACACCTGAGTAGACCGACGCCAGGAGGGGGAGGGGAAG AACGGAAAGTTAAGGTTAGACGAGAACTCTGAGCCGTCACCTGTTCTCTGTCAG

CCTGTGGATGAGAGTAAGCTGAGGCGTG - UNI14461 - TGACAGGGTATCATGTATGCCGCTGGTTCCAGGGGCCACTCCCCTGCTTTCCTGCAAC

CTCAAAACGGAAACGGCCACCGCTCACCTGGTTATGTTCCCGGGAAGGTGGTTCCCTTACGTCCCGCGCCTCCTCCAAAGAACCACGCCTCCGCCAAACT

GACCTCCAGGAGCCAAGACGCCCCAGCGACCTTTGCTTTCTCCCCCGAGGAGCAGCGGACTCCGAGCGAGAGCCGAAAGCGGAAGAGGCACAAGAACACC

TTCATCTGCTTCGCCATAACCAGCTTCTCGTTCTTTGTGGCGCTTGCGGTCATTTTGGGAATATCCTCAAAATACGCTCCAGATG - UNI24748 - A

GAATTGTCCAGATCAAAACCCTCGTCTCAGGAACTGGGATCCAGGACAAGATTCTGCGAAGCACATTGTTATCAAGGAGGGGGATTTGTTCCGCCTGACC

TCAGATGCAACAGTGGACTCTATAGTCATTCAGGATGGAG GACTGCTTGTGTTTGGGGATGATAAAGATGGATCCAAGAATATAACTTTGAGGACTCGA

TACATCCTGATCCAGGATGGTGGGGCGCTTCATATTGGAGCAGAAAAATGCCGCTATAGATCCAAAGCGACAATTACCTTGTATGGCAAGTCAGATGAAC

GTGAAAGTATGCCAATATTTGGCAAGAAGTTTATTGGCGTGGAGGCTGGCGGGACACTGGAGTTACACGGGGCACAGAGGACATCATGGACGATGCTGGC

GAGGACTCTGCATTCTTCAGGCTTGCCCTTTGGGTCTTATGCCTTCGAGAAGGACTTTTCCCGGGGCCTTAATGTGAGGGTCATTGATCAAGACACAGCC

AGAGTTTTAGAAAACGAGAAGTTCGATACCCACGAGTACCACAATGAGAGCAGGAGGCTGCAGGAGTTTTTGAGAGCTCAGGAGCCCGGCCGGATTGTGG

CTATTGCTGTTGGAGACTCAGCAGTCAAGAGCCTGTTACAGGGAACAATCCAGATGATCCAGGATCGGTTGGGGAGTAAACTGATCCAAGGTCTGGGCTA

CAG GCAAGCTTGGGCCTTAGTTGGTGTCATCGATGGTGGAAGTTCTTCCTGCAATGAATCTGTGAGAAACTATGAAAACCATAGCACTGGGGGGAAGGC

CCTGGCTCAAGGAGAATTCTACACCCTGGACGGTCAGAAGTTCTCTGTGACAGCCTACAGTGAATGGAGTCAAG GAATCTCCCTCTCAGGCTTCCGGGT

GGACATTGCGGATGGAGTGAAGCTTCACCTGTTGGACGACGTCAGCACTTGGGAAGCTGGAGACCGAATTGTGGTGGCCAGCACCGACTATTCCATGTAC

CAAGCAGAGGAGCTAACTCTTCTCCGCTGCCCCGAGTGCAGCCGTTCTCAGGTCAAAGTCAAAG - UNI9147 - AGATCCCCCAGTACCTGCACGTC

GGTGAGATCATAGACGGGATAGACATGAGAGCTGAGGTTGGACTTCTCACCCGCAACATTGTGATCCAAGGAGAGATGGAGGATTCATGCTATGCAGAAA

ATCACTGCCAGTTCTTCGATTATGACACCTTTGGGGGACACGTCATG ATAGAGAAGAATTTTACTTCAGTCCATCTTTCTTATGTGGAATTGAAACACA

TGGGCCAGCAGCATATGGGCCGGTATCCTGTGCATTTTCACCTGTGTGGAGATGTAGATTCTAAAGGAGGGTACAGCCAGCCAGCGTCTGTGGATGGCCT

GTCTGTTCATCACAGCTTTTCAAGGTGCATCACCGTGCACGGGACCAGTGGCTTGCTA ATCAAAGACACCATTGGCTTCGACACACTAGGTCATTGCTT

CTTTTTGGAAGATGGTGTTGAACAGCGAAATATTTTGTATCATAACTTGGGGCTTCTTACCAAGCCGGGCACTCTCCTCCCAACGGACAGGAACAGCTCC

ATGTGCACCGTCATGCGTGATGGAGTGTTTGGAAACTACGTCCCTGTGCCTACCACAGACTGCAT GGCTGTTTCAACTTTCTGGATTGCCCACCCCAAC

AACCACCTGATCAATAACGCAGCTGCAGGCTCACAG GATGCTGGAATATGGTATTTATTCCACAAGGAACCAACTGGGGAGTCCAGTGGGCTGCAGCTC

CTGGAGAAGCCAGAACTCACTCCGCTGGGGATATTTTATAACAACAGGGTTCATTCAAATTTTAAG GCTGGTTTATTTGTGGACAAAGGTGTCAAAACG

ACCAACGCCAGTGCATCTGACCCAAGGGAGTACCTCTGCCTGGATAACAGTGCAAG - UNI36628 - GTTTCGGCCCCATCAGGATGCAGACCCTGA

GAAGCCACGCGTTGCAGCCATCATCGACAGGCTCATTGCTTTTAAGAACAATGACAACGGAGCCTGGGTCAGAGGAGGAGATATTATTGTTCAGAATTCA

GC ATTTGCAGATAACGGAAAGGGGCTGACCTTTGCCAG TGATGGGAGCTTCCCAAGCGATGAAGGGTCCAGTCAGGAGGTGACAGAGTCCCTCTTTGT

CGGGGAGAGTAGGAATTACGGCTTTCAAGGTGGCCAAAACAAGTACATGGGCACAGGGGGAATCGATCAGAAGCCTCGGACGCTACCCAGGAACAG GAC

ATTCCCAATCCGAGGCTTTCAGATTTACGATGGGCCTATTCATCTCACAAAGAGTACTTTCAAAAAGTATGTGCCAACTCCAGACAGGTACAGCAGTGCA

ATTGGCTTCCTCATGAAGAATTCCTGGCAGACAACACCCAGGAATAACGTTTCCCTTGTGAAGTTTGGTCCACAG GTCTCTCTGAACGTCTTCTTTGGA

AAGCCTGGCCCCTGGTTTGAGGATTGTGAGCTGGACGGCGATAAGAACTCCATCTTCCATGACATTGATGGCTCTGTGACAGGATACAAGGACACCTATG

TGGGAAGGATGGACAACTACCTGATCCGCCATCCAAACTGTGTCAATGTTACTAAGTGGAATGCAGTGATCTGTAGCGGGACCTACGCCCAG GTGTATG

TTCAGACCTGGAACACTCCGAATCTTAGCATGATCATCACACGGGATGAATACCCATCCCACCCAATGGTGCTTCGGGGTATCAACCAGAGGGCCATCTC

TCCACAGTACCAGCCTGTTGTCATGCTGGAGAAGGGCTACACCATCCACTGGAATGGTCCAGCGCCACGAACCACTTTCTTGTACCTCGTGAACTTCAAC

AA GGATGACTGGATCCGGGTTGGCCTCTGTTACCCAGCCAACACGAGCTTTCAGGTTACCGTTGGCTTTCTGCAGCGGCAGAACGGCTCATTATCTAGA

ATTGAGGACTATGAGCCTGCGCGGTCGATGGAGGAACTGCAGAAGAAGCCGTCTGAGAGAAAATTCTATTTTGACTCTGGCACAGG GTTATTGTTTCTG

TATCTCAGAGCCCACAGCCACAGAGATGGCCACAGTTACTGTTCATCTCAGGGATGTGAAAGAGTCAAGATTCAGGCAGCAACAGACTCCAAAGATATCA

GTAACTGCATGGCCAAAGCGTACCCGCAGTATTACAAGAAGCCCTCGGCGGTCAAGCGCATGCCGGCCATGCTCACGGGGCTCTGTCAAGGCTGTGGAAC

CCACCAG ATGGTGTTTACCAGTGACCCTCACAAAAGCTACCTCCCTGTACGATTCCAGTCACCTGGGAAAGCAGAAATTCAGCGAGGAGATCCATCCAT

TATTTCC GTCAATGGTACTGACTTTACCTTCCGGAGTGCGGGTGCCCTCCTCCTCATTGTGGATGCCTGCAGTGTGCCCTTCCGGGTGAAGGAAAAGCG

GATGTTCCTTTCTGCAGACGTCAGTCACATGGAAGAATATTTCAAGGCTAGCATCCCCCCAAG GTCAATCGTTCTGTTGAGCACAAGAGGAGAAATTAA

GCAGCTGAATATCTCGGATTCATTAGCAGTTCTGGGACTGGCCAAGCCAGCACATCTGTACAGCAAAG GTAGTGTCGTATTTTTGGGATTCAGCGGAAA

CTTCGCACCGTCATGGACGAAGCTGTTCACCAGTCCCGATGAGCAGGGCCTCGGAGTGCTTGAGCAGTTTCTCCCGTTGCAGATGGAGGAATATGGGTGC

TCCCGGACCGGCAGTGTCCACAGAAGAGACCTTGACCTGTTACAGCAGGCTTTGAAAGTGCTTTAGAGACTTGGTTGTAATTTAAGTGCTGGGAAAGAAA

AAAAAAATGTGAACTAACTTATTTAATTTATGGCATTTTAAGACAACACTGTTAACCCGATGGAACCATTTTCCTGTTTGATAGAAAAGGGAGAGAAGGA

ATCCAAGCAGTTACCTGAGTGTCAGCTTGCAGGCCTTGGCACTGTGCAGGTGGTAGAGCCCTTTTGTCTTCCTGAGGCTGCTGCGTTCAGAGAGCAGTTG

GTCTCGTGGCCCTTGCTTTGACAAGCACATCGGGGGTGCTTTGCTTTTTGTATAGTGGGGTGCAGGGAGTCCAAGGGCTCCTTGAACTTGCTCCTTCGAG

GACTGGCTGCTCTAGCATTTCAGATACTTGAAGTCCAATGCTCAGTCCTGCGCTAACTCCAGTCGCTGCCCTGTTCAGTGATGTCTGGGGCTCATTTCTG

TACAGCCCACGAGGGTTTTATGTGATGCTAGATATGGTTTTAAGTGGCAACTCAGGCCCAGCACATGTCCTTTTTGCCTGGTCATGTGCTCTTTTTATTC

ACTTGTATACTGATTACTTTTGAGGGTTCACCTTTCAAAGAGGGAACCTTATTGGGACAAAAGGGCTTTTGAAATTTTTTAGATCTGTAACCATTGAGGA

AAAAAAAAGAAAGAAAGAAACAACAACATAAACCTATTACTTGCATCCAGGTGGAACTTTTTCTGCAGCTTTAATCCTTAACCTGTCTTGACCTTTAAAA

CGCAGAGCGGAACTGAATTAATTTTCTTTAAAAGCAGCAAGCCACTTCCTAAACTGTAAAACTCTTGTCATTTGAACTTGCAAAAGAAAGCCAGGTGTGG

TGGTGCACGCCTTTGATCACAGCACTCCAGGAGCAGGTGGATCTCTGAGAGTTTGAGGCTAGCCTGGTCTACGTAGTGATCCAGGACAGCCAGGGCTACG

TAGAGAAACCCTGTCTCAAAAGAAACAAAACAAAACAAAACAAAACAAAATCACTCTGTCAACAAAAGCTAACTTGCAAAAGGGAAACCTGTCCTTGGTT

TTGGTCTTGTACCTGTGCTTTGTTGTCTTGTTGTGTGGATTTTTTTTTTTTCCAAGCGGCTCTGCTCATTGTCCTACCAGAAAATCCCAGAGAGTTTCCC

GCTTGCTCCTCCATAAATATTGTATTCAAGGAAAGAAAGGAGATGCCTTCTTAGGGTGGAATCATGGAGGCAATGGACATGATCTTCTTTGTAGCCTTTA

AAAGAGGGAGTCTCTTAGTGAATGTAGCTTTCAAAGACAAGAAGAAAGGACTCTGGGTCTCCCAGTGCTGCTTCTACTGGCCCTTTCTTCAGCCAGTGGG

GACACATGTGGCAAAGGATGCTGGCTCTGCAGCCAAGAGGGAAGATGGCATCAGAATGCTGCTGTGCTGCCCAAAGGCGGGTGGCTGAATAGCCAGGCTG

ACGGTAGCAATTGAGTGCAGAAAAGTTCATCTTCCTCCGTGGAGGGCCGAGGCTGATGCCTGTATGTTGTGTCCAGGAGACATTCTAGGACAGCTCTGTG

ACTTGTGTAACTTTACAGAACATGCTACCTCAAAGTGCTGTGACAAACCATTTGGACTGTAGTGCTCACAGGATGGGCACGTGTCTTAATCAAAGTTTGG

TTACTTGTTTATCCGGGTTTTTTGGATGTGGGGTTTTTTGTTTGTATTTTTTTTTCTTTTTCTTTCATTCTTTTTTTTTTTCTTTTTTTTTTGTACAGTG

AGATCTTACCTATTAAATATATTTAGTGGGTCATGGTTCCTGAAGGTGAGTGAATTGATTGTGTGTGCAGATGTGTGTGTGTTATGACTTAAATATATTT

GTTTTGTGCTGTTTTAGAGTTCCTTTTTTATATATATTTGGAGAAAGTATGCAAGTTTCAAGGCACTCAGTGTTTCTGATTTTTATGTACTAATAATTAG

GGCCTAAGTTAAATAAATAAAAACGTGTGTGCATGTATTTTA
Translation
  - UNI14461 - MYAAGSRGHSPAFLQPQNGNGHRSPGYVPGKVVPLRPAPPPKNHASAKLTSRSQDAPATFAFSPEEQRTPSESRKRKRHKNTFIC

FAITSFSFFVALAVILGISSKYAPDE - UNI24748 - ENCPDQNPRLRNWDPGQDSAKHIVIKEGDLFRLTSDATVDSIVIQDGG GLLVFGDDKDG

SKNITLRTRYILIQDGGALHIGAEKCRYRSKATITLYGKSDERESMPIFGKKFIGVEAGGTLELHGAQRTSWTMLARTLHSSGLPFGSYAFEKDFSRGLN

VRVIDQDTARVLENEKFDTHEYHNESRRLQEFLRAQEPGRIVAIAVGDSAVKSLLQGTIQMIQDRLGSKLIQGLGYR RQAWALVGVIDGGSSSCNESVR

NYENHSTGGKALAQGEFYTLDGQKFSVTAYSEWSQG GISLSGFRVDIADGVKLHLLDDVSTWEAGDRIVVASTDYSMYQAEELTLLRCPECSRSQVKVK

E - UNI9147 - EIPQYLHVGEIIDGIDMRAEVGLLTRNIVIQGEMEDSCYAENHCQFFDYDTFGGHVM IEKNFTSVHLSYVELKHMGQQHMGRYPV

HFHLCGDVDSKGGYSQPASVDGLSVHHSFSRCITVHGTSGLL IKDTIGFDTLGHCFFLEDGVEQRNILYHNLGLLTKPGTLLPTDRNSSMCTVMRDGVF

GNYVPVPTTDCM MAVSTFWIAHPNNHLINNAAAGSQ DAGIWYLFHKEPTGESSGLQLLEKPELTPLGIFYNNRVHSNFK AGLFVDKGVKTTNASASD

PREYLCLDNSAR - UNI36628 - RFRPHQDADPEKPRVAAIIDRLIAFKNNDNGAWVRGGDIIVQNSA AFADNGKGLTFAS SDGSFPSDEGSSQE

VTESLFVGESRNYGFQGGQNKYMGTGGIDQKPRTLPRNR RTFPIRGFQIYDGPIHLTKSTFKKYVPTPDRYSSAIGFLMKNSWQTTPRNNVSLVKFGPQ

 VSLNVFFGKPGPWFEDCELDGDKNSIFHDIDGSVTGYKDTYVGRMDNYLIRHPNCVNVTKWNAVICSGTYAQ VYVQTWNTPNLSMIITRDEYPSHPMV

LRGINQRAISPQYQPVVMLEKGYTIHWNGPAPRTTFLYLVNFNK KDDWIRVGLCYPANTSFQVTVGFLQRQNGSLSRIEDYEPARSMEELQKKPSERKF

YFDSGTG GLLFLYLRAHSHRDGHSYCSSQGCERVKIQAATDSKDISNCMAKAYPQYYKKPSAVKRMPAMLTGLCQGCGTHQ MVFTSDPHKSYLPVRFQ

SPGKAEIQRGDPSIIS VNGTDFTFRSAGALLLIVDACSVPFRVKEKRMFLSADVSHMEEYFKASIPPR RSIVLLSTRGEIKQLNISDSLAVLGLAKPA

HLYSKG GSVVFLGFSGNFAPSWTKLFTSPDEQGLGVLEQFLPLQMEEYGCSRTGSVHRRDLDLLQQALKVL

For any suggestions or comments, please send an email to unitrap@crg.es