Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024759 (5730596K20Rik)
Chromosomal location
Chr 19: 7568971 - 7611090 (+)
Description
atlastin GTPase 3 Gene [Source:MGI Symbol;Acc:MGI:1924270]
RefSeq_dna
NM_146091 
RefSeq_peptide
NP_666203.2 
UniGene
Mm.264016 Mm.410202 
MGI
MGI:1924270 
Uniprot/SWISSPROT
Q91YH5 
Human Ortholog
ENSG00000184743 (ATL3)
Omim not available
UniTrap UNI6430
Vector Insertion
Chr 19: 7569152 - 7583837
Public Clones (sanger) XE436 (baygenomics) CSA046 (baygenomics) XE666 (baygenomics)
YHB218 (baygenomics) FHCRC-GT-S3-3B1 (fhcrc) IST10033H2 (tigm) IST12499C10 (tigm)
IST13062A4 (tigm)
Private Clones OST450847 (lexicon) OST348995 (lexicon) OST348738 (lexicon) OST338470 (lexicon)
OST306608 (lexicon) OST280000 (lexicon) OST67960 (lexicon) OST30878 (lexicon)
OST30710 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22171
Vector Insertion
Chr 19: 7584053 - 7584472
Public Clones not available
Private Clones OST305110 (lexicon) OST213455 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4385
Vector Insertion
Chr 19: 7584617 - 7591367
Public Clones AE0664 (sanger) (ggtc) M125C10 (ggtc)
Private Clones OST144962 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22432
Vector Insertion
Chr 19: 7605082 - 7606505
Public Clones not available
Private Clones OST297182 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025668
Sequence
GTAGGCTTTCTCCGCGCGCCCCTCCTTCTCGGTTTCTCCCCAAGTCCAGGCTCCGCCTGTTTCCCTCCTCCAGGGCAGCCTCAACCCGCTCCTGTCTTCT

CTGCCTCTGCTACTTCTGCTGAAGGAGGAGGCTCCATGTTGTCCCCTCAGCGAACTGCAGCGGTGGCATCGAGAGGAGCAG - UNI6430 - GTGATG

CCATGGAAAATGGAAAACCTGGTCCAGTGCAGGTTGTTTTGGTTCATAAAGAACAACATTCCTTTGAGCTAGAAGAGAGAGCCTTGGCCAGCGTCCTCCT

CCAAGACCATATCCGAGATCTTGATGTGGTGGTAGTATCAGTGGCTGGTGCTTTTCGAAAGGGTAAATCCTTCATTCTGGACTTTATGCTGCGATACTTA

TATTCTCAG - UNI22171 - AAGGAAGGTGGTCATTCAGACTGGTTGGGTGACCCAGAAGAACCTCTGACAGGATTTTCATGGCGAGGAGGCTCTGA

TCCAGAAACTACTGGGATTCAGATTTGGAGTGAAGTTTTCACTGTGAAGAAGCCATGTGGAAAAAAG - UNI4385 - GTTGCAGTTGTTCTGATGGA

TACCCAGGGGGCCTTTGACAGCCAGTCAACTGTGAAGGATTGTGCTACCATTTTTGCTCTAAGCACTATGACTAGTTCTGTTCAG ATTTACAATTTGTC

CCAGAATATTCAGGAAGATGATCTTCAGCAGCTACAG CTCTTCACAGAATATGGCCGCCTGGCAATGGATGAAATTTTCCAAAAACCTTTTCAG ACAC

TGATGTTTTTGATTCGAGATTGGAGTTTCCCTTATGAATATAACTATGGACTGCAAGGAGGAATGGCATTTTTGGATAAGCGTTTACAT GTGAAGGAAC

ATCAACATGAAGAAATTCAGAATGTGAGAAATCATATTCACTCATGTTTCTCCGATGTCACCTGTTTTCTCTTACCACATCCAGGGCTCCAGGTGGCCAC

AAGCCCCAACTTTGATGGGAAATTGAAAG ATATTGCTAGTGAATTCAAAGAGCAGTTACAGGCTCTAATACCATATGTACTAAATCCATCTAAATTAAT

GGAGAAGGAGATCAATGGTTCAAAAGTCACCTGCCGGGGATTGTTGGAATATTTTAAG GCATATATTAAAATTTACCAAGGAGAAGATCTGCCTCACCC

GAAGTCCATGCTTCAG GCCACTGCTGAAGCCAATAATTTGGCAGCTGCAGCCTCTGCCAAAGATATTTATTACAACAACATGGAAGAG - UNI22432

 - ATTTGTGGGGGAGAGAAACCTTATTTGTCTCCAGATATTTTAGAAGAGAAGCACCTAGAATTCAAACAACTTGCTCTGGACCACTTTAAGAAGATCA

AAAAGATGGGTGGGAAGGATTTCAGCTTCCGTTACCAGCAGGAACTGGAGGAGGAAATCAAAGAACTGTATGAGAACTTCTGCAAGCACAACGGCAGCAA

GAATGTCTTCAGCACCTTCCGAACCCCTGCAGTTCTGTTCACAGGCATAGCAGCATTGTACATAGCCTCGGGCTTCACGGGCTTCATTGGGCTTGAGGTT

GTGGCCCAGCTGTTCAACTGTATGGTTGGACTGCTCTTAATAGCACTCCTTACCTGGGGGTACATCAGATATTCCGGGCAGTATCGTGAGCTGGGTGGAG

CCATTGACTCCGGTGCAGCATATGTGTTAGAGCAG GCTTCTTCGCATATTGGTAATTCTACTCAGGCTGCAGTAAGGGATGCCGTTGTTGGGAGACCAC

CTGCTGATAAAAAATCTCAATAGCATCTTAATGGGAAGATCCAACAAGAGCCCAGTCAGCTTCTGGATTTCTGCCAATGCCATCACGGGTCCAATTCCAG

AGGAATGGCAGATCTGAGACCATTCTGGAAGATCTGAGACAGGGCACTGTAATAAATGAACTGACTTCTGCTCTGGTTTCCAACTCCACTTGGCTTGGAA

GCAGTTCTTTTTCTTGCTGTTACAGACTCAAGGCTACTCTTTTCTCTGTTCTCTGCTTTTTGCACTTTAAGGGGTGGGGGTGGGGCTAAAAGGAAAACAG

AAATGCAGCTTTTGAGTCTTTGATGTGCCACATAGTGCCTTTTCAGACCAGTGCATCCCTCTGCAGCCATGGAGGCTAAGGAACGGAGGGCAACCTCATG

AAATGTGGTTTTGGATCAATGTGGTTTTAGTTCTTTTGTACCTTTGAAGATTTGTCTTTTTAAAAGTTTACACCACTTGAAAAAGGCTCAGAAAGAAAGG

CCCACTGAAATGATGCTTTATTATCCTTCAAAAGTTTTCTCCCAGTACTGGTGATTGAACCTGTTGCCTGAGTATGCTAAGCAGTTGCTCTCCCCTGCAG

CTGCCCCCAGCCCACTTGACTGTGCAGACTCAGGGCTTGCAATTACTCGATTCTCCGCGGCTGAGCTTCCCATCGTCCTCTCTCCCTAAGGTCCTGAGTA

GTTGAATACAGACTTGTGGTGCCATCCTTGCTTCAAAAGCCATATTTATATGAGTTCTCTTTGCTATGCAGCATGAAAGACGTTAAGTCACTTAGTACTC

TGTTTCAGATTGTAAGGCCTTACACCGAGGAGGCTGGCAGTTTTGTCGACATTGCTTTCTTATTTTTATTTCTATAGCTTCTTTCTAGAAAAGAGGCAAA

CTATTCTTAAAAAGTCAGTGGTTCATAATAAAAGGAACTAGATACTCCATGGAAATTGTAGTTTGAATGAACCATGAGACCTCTGATAAAGTCACCTTGA

ATTTGTGTCTTGGTTAGATTCACTGTACATTTATGTCACTGTACATTTATGCCACAAAAATAGTCATTTTCAACAGAGAAAAGGCATGACCAAATATTAC

TCCTTTTAATTAATGTTCACTTTCATTTTGCCTAGCGGTAATACCAAATGATCTAATCTAAAGTCTCTACCTAAACTCTGTGTATGTGTGTGTGTGTATG

TGTCGCATGGTGTTTCCCTGGCGTGTAGACCAGGCTAGCCTTGAACTCATAGAGATATTTGTGCCTCTGTGTACCATTGTGCCTGGCCCTAAACTGCTTT

TTATTCTATATACTATCTAATGTTCATAATATCAAAGCTAGACTGTTAATTTTATTTAGTAAGTTTTCCCTTTTTTTTCCTCCATCGAAGAAGAAAGTGT

ACTCAGTCTAGCCAAACTATTTAAAATATCTCTTAAGCCAGGTGGCATTAGCACACACCTTTAGTCCCAACACTTCAGAGGCAGAGGCAGGTAGATCATC

TCTGTGAGTTTGAGGCCAACCTGGTCTACAGAGTTAAATTCCAGGATGGCCAGGGCTATCCAGAGAAACTGTCTCAAAAAACCAGAAAACAAATTCCCTC

TCGATTCTTCTTTTGGTTAGTCTAGCAGTTTGAAAATAATTGGCTTAGGAAGGATAATTGCTAAGACTCTCATATTTATTTTTTTACATTTACCTTGATT

ATGTGATAAAGTTTTATCTATTGCTTTTTTTCTTTGACTTGTAGTAGTGAATTATTGTGGACCTAAACCTTCTGAAGGTATAGAAGCCTTGATTTTGGAG

ATAATGTGAGATTTTGTTGCAGGAAGGAGATACAGGGTTTTGGCAAAGCCTAGTGTACCTTTTATGTACATGGAGTATGAGAGGAAGGTAAGAGAAAAGG

AAGTCTTCATTTCATTTCTCTTTAATGCACAACTTTCTTGTTAGTAACGGCTTTCCAGTCAAACATTTAATGAATCCTGAATTAATATTAAGTATTTTAT

ATATTTTCATACCATCTCATCCTGAAAATGTTAGTAGTTTTTCCTTTTGCTGTGACATTTGGGAATGGTTCCAACTTGTTTTAAAACTACTCACTGCTCG

TGAGTGATGGCTGACTGTAAGGGGCTTGAAACTCACTCCTGGCGTAGTGCAGAGTTTTTAGGTAATGTCCCCTATCCGAACGCTTGTATTGAGTTAAGTA

CTCCTGATACTGAGATAAGGTCAGAGAGGGTTTTGGGGACAGGGTTTTGTTATATAGTCTAGGTCAGCCTTTAACTTACTTTGTAGTTTAGACTGGCTTT

GAATTTGAGGTTTTGCTGCCTCAGACTCCCCAAGTGCTGAGCTTGTAGGAGTGTGTCCCCATGCCCACCTCTGGTTCTCTTAATGATGAGGAAGACGATG

TGGGGAAACTTTGCCATTGCTTCAGTATTACATCTGTGTGTGTGTTTAAAGTGAGTGTTCCATTAATTAGCTTACTCTGCTCCTGGGACATGTATATAAA

GTTTCTTTGAGGGTTGGCCTGTTTTCTAACTTTAAATTGTGGATTTTCTATTACAATTTTCAACACAAAATGCCTTTTTATGACTGG
Translation
MLSPQRTAAVASRGAG - UNI6430 - GDAMENGKPGPVQVVLVHKEQHSFELEERALASVLLQDHIRDLDVVVVSVAGAFRKGKSFILDFMLRYLYS

Q - UNI22171 - KEGGHSDWLGDPEEPLTGFSWRGGSDPETTGIQIWSEVFTVKKPCGKK - UNI4385 - VAVVLMDTQGAFDSQSTVKDCATI

FALSTMTSSVQ IYNLSQNIQEDDLQQLQ LFTEYGRLAMDEIFQKPFQ TLMFLIRDWSFPYEYNYGLQGGMAFLDKRLH VKEHQHEEIQNVRNHIHS

CFSDVTCFLLPHPGLQVATSPNFDGKLKD DIASEFKEQLQALIPYVLNPSKLMEKEINGSKVTCRGLLEYFK AYIKIYQGEDLPHPKSMLQ ATAEAN

NLAAAASAKDIYYNNMEE - UNI22432 - ICGGEKPYLSPDILEEKHLEFKQLALDHFKKIKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNV

FSTFRTPAVLFTGIAALYIASGFTGFIGLEVVAQLFNCMVGLLLIALLTWGYIRYSGQYRELGGAIDSGAAYVLEQ ASSHIGNSTQAAVRDAVVGRPPA

DKKSQ

For any suggestions or comments, please send an email to unitrap@crg.es