Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024773 (Atg2a)
Chromosomal location
Chr 19: 6241668 - 6262304 (+)
Description
ATG2 autophagy related 2 homolog A (S. cerevisiae) Gene [Source:MGI (curated);Acc:Atg2a-001]
RefSeq_dna
NM_194348 
RefSeq_peptide
NP_919329.2 
UniGene
Mm.277384 
MGI
MGI:1916291 
Uniprot/SWISSPROT
Q6P4T0 
Human Ortholog
ENSG00000110046 (ATG2A)
Omim not available
UniTrap UNI24130
Vector Insertion
Chr 19: 6241967 - 6244426
Public Clones (sanger)
Private Clones OST233536 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23159
Vector Insertion
Chr 19: 6244590 - 6244686
Public Clones not available
Private Clones OST274442 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37480
Vector Insertion
Chr 19: 6248290 - 6249771
Public Clones PST19227-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36417
Vector Insertion
Chr 19: 6251864 - 6252426
Public Clones IST13146F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000045351
Sequence
GTCCGGGGGCGCGGCCTGGCGCTGAGAGAAGCGGCGGGGCGAACCGGGGGCTCTAGTGAACAGCACAGCCGGACCGAGATCGCCGGCTGTCGGCCAGCGG

AAGCGGCTCGGGCCCGGCGGTCCCCGAGATGTCACGATGGCTGTGGCCATGGTCGAACTGTGTGAAAGAGCGTGTCTGCCGCTACTTGCTACAGCACTAC

TTGGGTCACTTCTTTCAGGAGCACCTCAGCCTGGACCAGCTCAGCCTGGATCTGTACAAGGGCAGCGTTGCCCTGCGGGATATTCACCTGGAAACCTGG 

- UNI24130 - TCTGTGAACGAGTTTTTGAGGTCAATGGAGTCACCACTGGAACTGGTGGAAGGCTTTGTGAGCTCCATCGAGGTGGCTGTCCCCTGG

GCTGCACTTCTCACTGACCACTGCACTGTGTGTGTGTCAGGCCTTCAGCTTACCCTGCAGCCCCGCCAGGGTTCAG - UNI23159 - GACCAGGGGC

TGCGGACTCTCAGAGTTGGGCCTCATGCATGACCACAAGCTTGCAGCTGGCTCAAGAGTGCCTTCGGGAAGGGTTGCCAGAACCCTCAGAACCACCACAG

CCCCTGGAGGGGCTGGAAATGTTTGCACAGACCATTGAGACTG TGCTCCGGAGGATCAAGGTGACCTTCCTGAACACTGTTGTGAGGGTGGAGCATTCA

CTGGGTGATGAGGATCGAAGTGTGGCTGTGGAGGTCCGAGTGCAGAG ACTGGAGTACTGTGACGAAGCAGTGCGGGACCCCAGCCAGGCCCCACCTGTG

GACGTGCACCAGCCGCCTGCCTTCCTGCACAAGCTGCTGCAGCTGAGTGGGGTCTGCCTATACTTTGAGGAGCTGCCCTCCCAGGCAGACCCACCACAGC

CACCTCTGCAAATCGGCAGCTGCACGGGGTACGTGGAGCTCATGGTGAGGCTGAAGCAGAACGAGGCCTTTCCAGGCCCCAAG TTGGAGGTATCAGGAC

AACTGGGATCCCTGCACCTGCTTTTGACCCCGCGTCAGCTCCAGCAGCTCCAGAGGCTGCTCAGTGCCGTCAACCTTGCAG ACCCTGCAGGCCTGGCCG

ACAAGCTGAACAAGAGCCGTCCACTGGGTGCTGAGGACTTGTGGCTCATTGAGCAAGATCTGAACCAGCAGCTGCAGGCGGGTGCTGTGGCTGAGTCCCT

CAGCCTGTACCCCATCACCAACCCCCTCAATTTGGACAGCACGG ACCTCTTCTTCTCCATGGCCGGCCTCACAAGCAGTGTGACATCGGCTGTCTCTGA

GCTCTCCGTGTACAGCGTAGACCTGGGCTCCTCTGTTCACAGCAACATGGCCTTCCACCGACCCTCAACCCCACCCCACTCGGGTG GCAAGATGGCCCC

AACTCCCCTTCTGGACACCACACGCCCTGACTCACTGGTGAAGATGACCTTGGGCGGTGTGAGCTTGACCTTGCTGCAGACTGCTTCCCCGTCTTCAGGA

CCATCTGACCTCCCCACCCACTTTTTTGCTGAGTTCGATGCTGCCAAAGATGGGCCATTCGGCTCCCGGGACTTCTCCCATCTCAGGCCACGCTTCCAGA

GGGCCTGCCCTTGTAGCCACGTCCG GTTAACTGGCACAGCCGTGCAGCTGTCCTGGGAGCTGCGCACGGGCAGCCACAGCCGGAGGACAAGCAGCACCG

AAGTGCACTTTGGACAGCTGGAGGTGCTGGAGTGCCTATGGCCCAGGGCTGCCACAGAGCCAGAGTACACGGAG ATCCTGAGCTTCCCCAGTCACTCTG

GCTCCGAAGCCTCAGCCCGACCCTGCGCCCATCTGCGCCACACACAGACCATTCGCCGGGTGCTCAAG AGCCGGTCCCGGCGCTCCACTGCCTGCCATT

GTCACTCAGAACTGTCCCTGGACCTGGCCGACTTCCAATCTGATGTGGAGCTGGGGTCCCTGGACCGCCTTGCTGCCTTGTTCCGTCAAGTCACCACACC

CTCTGAGCCACCTGCTGGCCTACTA ACAGAGCCCCCACAGGCCACTGAGCTGCAGACAGTGTTTCGTCTCTCAGCACCCCGGGCCACCCTGAGGCTACG

CTTCCCCATCCCAGACCTACGGCCTGACCGGGACCCCTGGGCTGGCCAGGCTGTGCGGGCTGAGCAGCTGCGACTGGAGCTGAGTGAGCCCCAGTTCCGC

TCAGAGCTCAACAGTGGGCCTGGCCCCCCAGCTCCTACCCGCCTGGAACTTACTTGCTCAGACCTGCAAG GAATCTACGAAGATGGAGAGAAGCCACCA

GTCCCCTGCCTGCGGGTCTCCAAAGCTCTGAATCCCAGGAGCACTGAGGCCAAGTACTTTCTACCTCA GGTAGTGGTGACCCTGAACCCCCAGTCCAGT

GGCACACAGTGGGAGACAGCCTATGAGAAAGGCCGGGATCTAGAGCTGTCCACCGAGAGTCCGTGTGAGCTACAGCAACCTGAGCCCTCGCCCTTCTCCT

CCAAGCGGACCATGTACGAGACTGAGGAA ATGGTGATCCCTGGAGACCCTGAAGAGATGAGGACATTCCAGAGCCGGACACTGGCACTGTCCCGCTGTA

CTCTGGATGTGATCATGCCCAGTGCCCACATCTTCCTGCCCAGTAAGGAGGTCTACGAAAGTATCTACAACAG GATCAATAACGACCTGCTCATGTGGG

AGCCTGCAGACCTGCTTCCCACATCCAGCGCTGCTGCTCGGCCGCCTGGCTCTTCGGGGTTCAAGATGTGCAAGTCAGCCTTCAAGCTAG ACTCGGATT

CAGATGAAGAAGACGCCCAGTTCTTCTCGATGGCATCAGGTGTCCCCCAGACACCTGCCCCAGAACCTTCCCGTCGTCAGTCCCAGAGTACCTTCTCCAC

ACTGGTGACAGTGCTGAAGGGTCGGATCACTGCGCTCTGTGAGGCTAAG - UNI36417 - GATGAGACAGGGAAGCGGCTGGATGTCACTCACGGGG

AGCTGGTACTAGATGTGGAGCAAGGCACCATCTTCAGCGTAGCCCAGTACCGTGGCCAACCAGGGCTTGGCTACTTCTGCCTGGAAGCTGAAAAGGCCAA

ACTCTACCATCGAG CGGCCATTGAAGACTACCTGCTACCCACTCATTTGGAAGTGCCCAGCTTTGCTCCCCCCGCTCAGCTGGCTCCAACCATCTACCC

ATCAGAGGAAGGGGTGACTGAGCGAGGAACCTTGGGCCGCAAGGGCCAGGGTCCCCCCATGCTGTCTGCAGCTGTCCGTATCCACCTGGACCCTCACAAG

AATGTCAAG GAATTTTTGGTGACAGTACGGCTGCACAAAGCCACTCTACGCCACTACATGGCCCCACCTGAACAGAGCTGGCACTCCCAG CTCCTGGA

CTTCTTGGATGTGCTGGATGACCCTGTGCTGGGATACCTGCCCCCAACCGTCATCACTGTCCTGCACACACATCTCTTCTCCTGCGCTGTGGACTACAG 

GCCCCTCTACCTCCCTGTGCGTGTCCTGGTCACTGCTGAGACCTTCACCCTCTCCAGCAACATTGTCATGGACACGTCCACCTTCCTGCTCAG GTTCAT

CCTTGATGACTCCGCTCTGTACCTGTCTGACAAGTGTGAGGTGGAGAGCCTGGATCTGCGGCGAG ATTATGTCTGTGTCCTGGATATTGACCTCCTGGA

ACTTGTCATCAAAACCTGGAAGGGCAGCACTGAGGGCAGACTG AGCCAGCCTCTGTTTGAGCTGCGCTGCTCCAACAACGTGGTGCACGTGCATAGCTG

TGCTGACTCCTGCGCCCTGCTGGTCAACCTGCTCCAGTACCTAACCAGCTCGGGTGACCTGCACCCCCCACCCCGGCCCCCCAGCCCTACAGAGATCGCT

GGCCAGAAG CTTTCGGAGAGCCCTGCCTCCCTGCCCTCATGCCTACCTGTGGAGACAGCCCTCATCAACCAACGAGACCTGACTGACGCCCTTCTGGAT

ACTGAACGGCGCGGCCTGCAGGAGCTGGCCCAGTCATCGG GTGGCCCACTTCCTCAGGCCTCTCCCGTCTCCGTCTATCTGTTCCCAGGTGAACGGAGT

GGGGCCCAGGCCCCTTTGCCTCCTCCTGGGGCCTCTTCTCATACCTTGGGTTCTAAGGCAAAGGAACATGAAAACGAAGAGGAAGGGGACGGAGACACCC

TGGACAGTGATGAGTTCTGCATCCTTGACGCCCCTGGCCTAGGCATTGCG CCTCGAGACGGGGAGCCCATCGTGACACAGCTGCATCCAGGCCCCATCA

TCGTGCACGACGGTCACTTCTCCCAGCCCCTGGGAAGCACTGACCTGCTGCGCGCTCCTGCCCACTTCCCAGTGCCCAGCAGCCGTGTGGTACTACGGGA

GGTCTCCTTCATCTGGCACCTCTATGGGGGTAGAGACTTTGGCCTTCACCCCACTTACAG AGCAAGAGTAGGCCTCACAGGCCCCAGGGTCTCACCTTC

CCGCTCCTCTGGTCCCAACCGTCCCCAGAACTCCTGGCGTACCCAGGGTGGCATTGGACGGCAACACCAGGTCCTCATGGAGATCCAGCTCAGCAAA GT

GAGCTTCCAGCATGAAGTGTACCCAGAAGAGTCGGCCATAGCTGGGGGCCTGGGCCAGGAGCTGGACGAGCGACCACTGTCGCGCCAGGTGCTCATTGTT

CAAGAGCTAGAGATCCGAGACCGGCTGGCCACCTCCAAGATCAACAAGTTTCTTCATTTGCACACGAGTGAGCGGCTGCCACGGCGCACACACTCCAACA

TG CTTACCATCAAGGCACTGCATGTGGCTCCCACCAGCAGCGTCGGAGGGCCGGAGTGCTGTCTTCGAGTCTCCATGATGCCTCTGAGGCTCAATGTGG

ACCAG GATGCCCTCTTCTTCCTCAAGGACTTTTTCACCAGCCTAGCAGCCAGTATCAACCCCATGGTCCCAGGGGACACTTCTGAGG CTCCCCGAGAG

ACCCACAGCCGGCCCGGCAGCCCCCAGGAAGGGCAGTCTGAGGACACAGAGACAGCCAGCAACCCACCGGAAGCTCCAGGCAGTAGCCACAGCTCCTCTG

ACCAGCAGCCTATCTACTTCAG GGAGTTCCGCTTCACATCTGAGGTGCCCATCTGCCTGGATTACCATGGCAAGCATGTCACTGTGGACCAGGTG GGC

ACTTTCATGGGACTCCTAATCGGCCTGGCCCAGCTCAACTGCTCAGAGCTGAAGCTCAAGAGGCTCTGCTGCCGGCATGG GCTCCTGGGTGTGGACAAG

GTGCTGTGCTATGCCCTCAATGAATGGCTGCAGGACATCCGTAAGAACCAGCTGCCCGGCCTGCTGGGAGGCGTGGGCCCCATGCACTCGGTTGTGCAGC

TCT TCCAAGGGTTCCGGGACCTGCTGTGGCTACCCATCGAGCAGTACAGGAAAGATGGGCGCCTCATTCGGGGGCTGCAGCGTGGGGCTGCCTCCTTTG

GGTCATCCACAGCCTCTGCTGCTCTGGAACTGAGCAACAGGCTGGTCCAGGCCATCCAG GCTACAGCTGAGACAGTGTATGACATCCTGTCCCCGGCTT

CTCCTGTCTCCCGATCCCTACAAGACAAGCGCTCTTCGCGGAAGCTACGCAGAGGTCAACAACCTGCTGACCTCCGGGAAGGCATGGCTAAGGCTTATGA

TGCTGTTCGAGAG GGTATCCTGGATACAGCTCAAACCATCTGTGATGTGGCATCCAGGGGCCATGAGCAGAAGGGACTGACAGGTGCCGTGGGGGGTGT

GATCCGACAGCTCCCCCCAACCGTGGTAAAACCAATAATCGTAGCAACAGAGGCAACATCCAACGTGCTAGGGGGCATGCGTAACCAGATCCTTCCAGAT

GCGCACAAGGACCATGCTCTCAAGTGGCGATTGGAGGAGGCCCAGGACTGACTGCAGGCACCCAAGATCCACCCACTGTCCCAACATGCTCACCGTGTCC

AGCCAGCCACAGTGGTGCCACCAGCTCCCTGTTTTCCTGATTGCTGTGACCCACAGCTAGGCCACCAGGTCCTTCAAAGGATGGCCACTGTGAAGGATAC

CTGCCCAGCCTGCTTGTTGCCAACTGGCCGAGAGAGTGGGGCCTCCCGGCTTTGGGGCCTCTGCCCTGTCTGTGCACTTTCATCTGGGGAGAAAGGACAT

TGCTTCTCCCTGCTACCTGGGCCCACACTGCTGCCTTGTTCCAGAATGAGGATGGAGGCTTTTGGACCCATGGACCCCACTCAGCCAAGTGTCTCTCCGT

GTCTCACGGGGAGGTGGGGGATAGATGCCATGTGGGTCGGTGTATTTTTAAGATCTCTGAGCGTGTGGGTCAGTGTCTGCATGAAGTGGAATAAACTTGC

CCACCGCCAGCCCAGGCC
Translation
MSRWLWPWSNCVKERVCRYLLQHYLGHFFQEHLSLDQLSLDLYKGSVALRDIHLETW - UNI24130 - SVNEFLRSMESPLELVEGFVSSIEVAVPW

AALLTDHCTVCVSGLQLTLQPRQGSG - UNI23159 - GPGAADSQSWASCMTTSLQLAQECLREGLPEPSEPPQPLEGLEMFAQTIETV VLRRIKV

TFLNTVVRVEHSLGDEDRSVAVEVRVQR RLEYCDEAVRDPSQAPPVDVHQPPAFLHKLLQLSGVCLYFEELPSQADPPQPPLQIGSCTGYVELMVRLKQ

NEAFPGPK LEVSGQLGSLHLLLTPRQLQQLQRLLSAVNLAD DPAGLADKLNKSRPLGAEDLWLIEQDLNQQLQAGAVAESLSLYPITNPLNLDSTD D

LFFSMAGLTSSVTSAVSELSVYSVDLGSSVHSNMAFHRPSTPPHSGG GKMAPTPLLDTTRPDSLVKMTLGGVSLTLLQTASPSSGPSDLPTHFFAEFDA

AKDGPFGSRDFSHLRPRFQRACPCSHVR RLTGTAVQLSWELRTGSHSRRTSSTEVHFGQLEVLECLWPRAATEPEYTE ILSFPSHSGSEASARPCAHL

RHTQTIRRVLK SRSRRSTACHCHSELSLDLADFQSDVELGSLDRLAALFRQVTTPSEPPAGLL TEPPQATELQTVFRLSAPRATLRLRFPIPDLRPDR

DPWAGQAVRAEQLRLELSEPQFRSELNSGPGPPAPTRLELTCSDLQG GIYEDGEKPPVPCLRVSKALNPRSTEAKYFLPQ QVVVTLNPQSSGTQWETA

YEKGRDLELSTESPCELQQPEPSPFSSKRTMYETEE MVIPGDPEEMRTFQSRTLALSRCTLDVIMPSAHIFLPSKEVYESIYNR RINNDLLMWEPADL

LPTSSAAARPPGSSGFKMCKSAFKLD DSDSDEEDAQFFSMASGVPQTPAPEPSRRQSQSTFSTLVTVLKGRITALCEAK - UNI36417 - DETGKR

LDVTHGELVLDVEQGTIFSVAQYRGQPGLGYFCLEAEKAKLYHRA AAIEDYLLPTHLEVPSFAPPAQLAPTIYPSEEGVTERGTLGRKGQGPPMLSAAV

RIHLDPHKNVK EFLVTVRLHKATLRHYMAPPEQSWHSQ LLDFLDVLDDPVLGYLPPTVITVLHTHLFSCAVDYR RPLYLPVRVLVTAETFTLSSNIV

MDTSTFLLR RFILDDSALYLSDKCEVESLDLRRD DYVCVLDIDLLELVIKTWKGSTEGRL SQPLFELRCSNNVVHVHSCADSCALLVNLLQYLTSSG

DLHPPPRPPSPTEIAGQK LSESPASLPSCLPVETALINQRDLTDALLDTERRGLQELAQSSG GGPLPQASPVSVYLFPGERSGAQAPLPPPGASSHTL

GSKAKEHENEEEGDGDTLDSDEFCILDAPGLGIA PRDGEPIVTQLHPGPIIVHDGHFSQPLGSTDLLRAPAHFPVPSSRVVLREVSFIWHLYGGRDFGL

HPTYR RARVGLTGPRVSPSRSSGPNRPQNSWRTQGGIGRQHQVLMEIQLSK VSFQHEVYPEESAIAGGLGQELDERPLSRQVLIVQELEIRDRLATSK

INKFLHLHTSERLPRRTHSNM LTIKALHVAPTSSVGGPECCLRVSMMPLRLNVDQ DALFFLKDFFTSLAASINPMVPGDTSEA APRETHSRPGSPQE

GQSEDTETASNPPEAPGSSHSSSDQQPIYFR REFRFTSEVPICLDYHGKHVTVDQV GTFMGLLIGLAQLNCSELKLKRLCCRHG GLLGVDKVLCYAL

NEWLQDIRKNQLPGLLGGVGPMHSVVQLF FQGFRDLLWLPIEQYRKDGRLIRGLQRGAASFGSSTASAALELSNRLVQAIQ ATAETVYDILSPASPVS

RSLQDKRSSRKLRRGQQPADLREGMAKAYDAVRE GILDTAQTICDVASRGHEQKGLTGAVGGVIRQLPPTVVKPIIVATEATSNVLGGMRNQILPDAHK

DHALKWRLEEAQD

For any suggestions or comments, please send an email to unitrap@crg.es