Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024790 (Sac3d1)
Chromosomal location
Chr 19: 6116004 - 6118586 (-)
Description
SAC3 domain containing 1 Gene [Source:MGI Symbol;Acc:MGI:1913656]
RefSeq_dna
NM_133678 
RefSeq_peptide
NP_598439.3 
UniGene
Mm.303924 Mm.467584 Mm.468606 
MGI
MGI:1913656 
Uniprot/SWISSPROT
A6H687 
Human Ortholog
ENSG00000168061 (SAC3D1)
Omim not available
UniTrap UNI22177
Vector Insertion
Chr 19: 6116589 - 6117796
Public Clones not available
Private Clones OST304857 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13053
Vector Insertion
Chr 19: 6116547 - 6116588
Public Clones CMHD-GT_358D12-3 (cmhd) CMHD-GT_363F9-3 (cmhd)
Private Clones OST262695 (lexicon) OST144570 (lexicon) OST21974 (lexicon) OST5767 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025703
Sequence
ATGGGACGATTTAAGGGGGAAAACCGAAGCCAGGCGCGATGGATTATGGGAGGCGTTTCTAAAGGCCGCGGGAGCGGCAAATCGAGAAAGCCGCGGCAGG

CTGCGTTTGGCCAGACTGGGGCTCGAGTCTGTCCCTCGAGCCCACGGCAGGATGCAGTGCCGCGCTTCCGCTGGCCCGGCGATGCTGAGTGTGCGTCCTC

TACCCACACCCCTACCATGTCCGGCTGCAAACTACCCATGGGCCTGTGCCCAGACATGTGCCCGGCCGCCGAGCGCGCCCGACGCGAGCGCGAGCGCCGC

CTGCACCGACTGGAGGTGGAGCCAGGCGGCCGTGGGAACGCTCCCCGAGCCGACCCCAAGCGCACAGTGAAGGAGTACAGCCGGCCGGCAGCGGGCAAAC

CCCGGCCCCCGCCAAGCCTGCTGCGGCCGCCGCCAGTGCTCTTAGCCACCGTGCGTTATCTGGCCGGTGAGGTGGCTGGCCGCGGCGACGTGTCGTGCGC

GGAGGTGGCGAGCTTTGTGGCCGACCGCCTGCGCGCAGTGCGGCTAGATCTGTCGCTGCAGGGCGTGGACGACGCGGACGCAGCGACAGTGCTGGAGGCT

GCGCTGGCCACGCTGCTGGCCGTGGTGGCGCGGGTGCGGCCAGAAGAGACGCGCGGAGCCGCGGACCCGGTGCTGCTTCAGACTCAGGTGCAGGAAGGCT

TCGGTTCGCTGCGGCGCTGCTACGCGCGGGGCAAAGGCCCCTACCCCCGCCAGGCTGCTTTTCAGGGCCTCTTTCTGCTCTACAACTTGG - UNI2217

7 - GGTTCTGTGGAAGCCCTGCAGGAGGTTCTACAGCTGCCTGC - UNI13053 - CTGCGTGCCTGCCCACCCCTTCAGGCGGCGTTGGCTGTTGA

CGCTGCCTTCCGGGAAGACAACCATGCCCGACTGTTTCGCCTGCTTCGCACCTTACCCTACCTACAGAGCTGCGCAGTGCAGGAACACATTGGGTATGCC

CGCCGCAAAGCTCTAGCCCGCCTGTCCCGTGCCCTGAGCACTCCTAAGGGACAGACCTTGCCTTTGGACTTCATAGAACACTTTCTGGCCCTGGATGGAC

TCCAGGAAGCACGGGACCTGTGCCAGGCCCATGGACTGACCTTGGATAAAGACAGAGTTGTATTCCTGAGGGGTCAATACTCTGAGGAAGGACTCCCACC

CCCTGGTGCCTACCACATATTAGTGGGGAATAAGTTGCAGGGACACACCCTGGAAGATGTGGTCATGGCTGAGGAAGGTGACATTCACAGACCTGGCTCT

GCAGCTTGA
Translation
MGRFKGENRSQARWIMGGVSKGRGSGKSRKPRQAAFGQTGARVCPSSPRQDAVPRFRWPGDAECASSTHTPTMSGCKLPMGLCPDMCPAAERARRERERR

LHRLEVEPGGRGNAPRADPKRTVKEYSRPAAGKPRPPPSLLRPPPVLLATVRYLAGEVAGRGDVSCAEVASFVADRLRAVRLDLSLQGVDDADAATVLEA

ALATLLAVVARVRPEETRGAADPVLLQTQVQEGFGSLRRCYARGKGPYPRQAAFQGLFLLYNLG - UNI22177 - GFCGSPAGGSTAAC - UNI13

053 - LRACPPLQAALAVDAAFREDNHARLFRLLRTLPYLQSCAVQEHIGYARRKALARLSRALSTPKGQTLPLDFIEHFLALDGLQEARDLCQAHGLT

LDKDRVVFLRGQYSEEGLPPPGAYHILVGNKLQGHTLEDVVMAEEGDIHRPGSAA
Transcript ENSMUST00000113533
Sequence
ATGGGACGATTTAAGGGGGAAAACCGAAGCCAGGCGCGATGGATTATGGGAGGCGTTTCTAAAGGCCGCGGGAGCGGCAAATCGAGAAAGCCGCGGCAGG

CTGCGTTTGGCCAGACTGGGGCTCGAGTCTGTCCCTCGAGCCCACGGCAGGATGCAGTGCCGCGCTTCCGCTGGCCCGGCGATGCTGAGTGTGCGTCCTC

TACCCACACCCCTACCATGTCCGGCTGCAAACTACCCATGGGCCTGTGCCCAGACATGTGCCCGGCCGCCGAGCGCGCCCGACGCGAGCGCGAGCGCCGC

CTGCACCGACTGGAGGTGGAGCCAGGCGGCCGTGGGAACGCTCCCCGAGCCGACCCCAAGCGCACAGTGAAGGAGTACAGCCGGCCGGCAGCGGGCAAAC

CCCGGCCCCCGCCAAGCCTGCTGCGGCCGCCGCCAGTGCTCTTAGCCACCGTGCGTTATCTGGCCGGTGAGGTGGCTGGCCGCGGCGACGTGTCGTGCGC

GGAGGTGGCGAGCTTTGTGGCCGACCGCCTGCGCGCAGTGCGGCTAGATCTGTCGCTGCAGGGCGTGGACGACGCGGACGCAGCGACAGTGCTGGAGGCT

GCGCTGGCCACGCTGCTGGCCGTGGTGGCGCGGGTGCGGCCAGAAGAGACGCGCGGAGCCGCGGACCCGGTGCTGCTTCAGACTCAGGTGCAGGAAGGCT

TCGGTTCGCTGCGGCGCTGCTACGCGCGGGGCAAAGGCCCCTACCCCCGCCAGGCTGCTTTTCAGGGCCTCTTTCTGCTCTACAACTTGG - UNI1305

3 - - UNI22177 - GTTCTGTGGAAGCCCTGCAGGAGGTTCTACAGCTGCCTGCTGCCCTGCGTGCCTGCCCACCCCTTCAGGCGGCGTTGGCTGTT

GACGCTGCCTTCCGGGAAGACAACCATGCCCGACTGTTTCGCCTGCTTCGCACCTTACCCTACCTACAGAGCTGCGCAGTGCAGGAACACATTGGGTATG

CCCGCCGCAAAGCTCTAGCCCGCCTGTCCCGTGCCCTGAGCACTCCTAAGGGACAGACCTTGCCTTTGGACTTCATAGAACACTTTCTGGCCCTGGATGG

ACTCCAGGAAGCACGGGACCTGTGCCAGGCCCATGGACTGACCTTGGATAAAGACAGAGTTGTATTCCTGAGGGGTCAATACTCTGAGGAAGGACTCCCA

CCCCCTGGTGCCTACCACATATTAGTGGGGAATAAGTTGCAGGGACACACCCTGGAAGATGTGGTCATGGCTGAGGAAGGTGACATTCACAGACCTGGCT

CTGCAGCTTGAGAGGGTCTCGTCTCCCACAAGGCCTGGGTCAGAGCACCTGGCTTCTTTTTCATAATTCCCAAACAATAAAAGGAACTCATTATGATCTC

C
Translation
MGRFKGENRSQARWIMGGVSKGRGSGKSRKPRQAAFGQTGARVCPSSPRQDAVPRFRWPGDAECASSTHTPTMSGCKLPMGLCPDMCPAAERARRERERR

LHRLEVEPGGRGNAPRADPKRTVKEYSRPAAGKPRPPPSLLRPPPVLLATVRYLAGEVAGRGDVSCAEVASFVADRLRAVRLDLSLQGVDDADAATVLEA

ALATLLAVVARVRPEETRGAADPVLLQTQVQEGFGSLRRCYARGKGPYPRQAAFQGLFLLYNLG - UNI13053 - - UNI22177 - GSVEALQEV

LQLPAALRACPPLQAALAVDAAFREDNHARLFRLLRTLPYLQSCAVQEHIGYARRKALARLSRALSTPKGQTLPLDFIEHFLALDGLQEARDLCQAHGLT

LDKDRVVFLRGQYSEEGLPPPGAYHILVGNKLQGHTLEDVVMAEEGDIHRPGSAA

For any suggestions or comments, please send an email to unitrap@crg.es