Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024812 (Tjp2)
Chromosomal location
Chr 19: 24169160 - 24248522 (-)
Description
tight junction protein 2 Gene [Source:MGI Symbol;Acc:MGI:1341872]
RefSeq_dna
NM_011597 
RefSeq_peptide
NP_035727.2 
UniGene
Mm.104744 
MGI
MGI:1341872 
Uniprot/SWISSPROT
Q9Z0U1 
Human Ortholog
ENSG00000119139 (TJP2)
Omim 607748 - HYPERCHOLANEMIA, FAMILIAL  
UniTrap UNI14315
Vector Insertion
Chr 19: 24213268 - 24248523
Public Clones (sanger) P125H02 (ggtc) D027F11 (ggtc) E047F04 (ggtc) P148F04 (ggtc)
D040G05 (ggtc) P115D05 (ggtc) P103G01 (ggtc) D137G05 (ggtc) FHCRC-GT-S20-11E1 (fhcrc)
IST14647F1 (tigm) IST13841E10 (tigm) IST12861A3 (tigm)
Private Clones OST500224 (lexicon) OST469855 (lexicon) OST469439 (lexicon) OST459569 (lexicon)
OST453289 (lexicon) OST451132 (lexicon) OST450924 (lexicon) OST448893 (lexicon)
OST446564 (lexicon) OST446538 (lexicon) OST434872 (lexicon) OST432268 (lexicon)
OST429242 (lexicon) OST428073 (lexicon) OST426330 (lexicon) OST426169 (lexicon)
OST423863 (lexicon) OST422651 (lexicon) OST422073 (lexicon) OST414767 (lexicon)
OST414180 (lexicon) OST411110 (lexicon) OST404812 (lexicon) OST402161 (lexicon)
OST401893 (lexicon) OST391322 (lexicon) OST391196 (lexicon) OST389956 (lexicon)
OST388467 (lexicon) OST381989 (lexicon) OST379045 (lexicon) OST374620 (lexicon)
OST374255 (lexicon) OST371407 (lexicon) OST364999 (lexicon) OST347749 (lexicon)
OST346702 (lexicon) OST336885 (lexicon) OST333140 (lexicon) OST320301 (lexicon)
OST316999 (lexicon) OST315733 (lexicon) OST309839 (lexicon) OST300381 (lexicon)
OST300361 (lexicon) OST299692 (lexicon) OST299298 (lexicon) OST298651 (lexicon)
OST294306 (lexicon) OST291395 (lexicon) OST289596 (lexicon) OST288222 (lexicon)
OST285902 (lexicon) OST280801 (lexicon) OST280795 (lexicon) OST279602 (lexicon)
OST278345 (lexicon) OST274363 (lexicon) OST269639 (lexicon) OST267665 (lexicon)
OST266564 (lexicon) OST266533 (lexicon) OST266119 (lexicon) OST260580 (lexicon)
OST252964 (lexicon) OST252883 (lexicon) OST249132 (lexicon) OST248979 (lexicon)
OST246702 (lexicon) OST246531 (lexicon) OST245707 (lexicon) OST234776 (lexicon)
OST232916 (lexicon) OST227219 (lexicon) OST225974 (lexicon) OST222963 (lexicon)
OST214097 (lexicon) OST210129 (lexicon) OST208866 (lexicon) OST208066 (lexicon)
OST207628 (lexicon) OST206225 (lexicon) OST193567 (lexicon) OST193349 (lexicon)
OST174804 (lexicon) OST172769 (lexicon) OST169259 (lexicon) OST168172 (lexicon)
OST158346 (lexicon) OST154880 (lexicon) OST149324 (lexicon) OST116067 (lexicon)
OST114933 (lexicon) OST103643 (lexicon) OST103629 (lexicon) OST102974 (lexicon)
OST99762 (lexicon) OST85088 (lexicon) OST69038 (lexicon) OST61545 (lexicon)
OST59787 (lexicon) OST55733 (lexicon) OST55546 (lexicon) OST54523 (lexicon)
OST50071 (lexicon) OST44706 (lexicon) OST41236 (lexicon) OST39946 (lexicon)
OST39839 (lexicon) OST34789 (lexicon) OST33860 (lexicon) OST30358 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15883
Vector Insertion
Chr 19: 24209465 - 24213268
Public Clones not available
Private Clones OST471025 (lexicon) OST470391 (lexicon) OST430370 (lexicon) OST428782 (lexicon)
OST420473 (lexicon) OST414228 (lexicon) OST405738 (lexicon) OST379181 (lexicon)
OST373804 (lexicon) OST359506 (lexicon) OST334015 (lexicon) OST333449 (lexicon)
OST321142 (lexicon) OST309404 (lexicon) OST304484 (lexicon) OST298066 (lexicon)
OST270956 (lexicon) OST267347 (lexicon) OST249932 (lexicon) OST247197 (lexicon)
OST245622 (lexicon) OST244436 (lexicon) OST242414 (lexicon) OST239959 (lexicon)
OST234322 (lexicon) OST227098 (lexicon) OST227073 (lexicon) OST226816 (lexicon)
OST216551 (lexicon) OST216335 (lexicon) OST214873 (lexicon) OST212340 (lexicon)
OST211611 (lexicon) OST195451 (lexicon) OST194098 (lexicon) OST186741 (lexicon)
OST186015 (lexicon) OST184528 (lexicon) OST181866 (lexicon) OST173693 (lexicon)
OST169681 (lexicon) OST166484 (lexicon) OST161609 (lexicon) OST153901 (lexicon)
OST122963 (lexicon) OST87792 (lexicon) OST74183 (lexicon) OST68185 (lexicon)
OST56268 (lexicon) OST51543 (lexicon) OST46482 (lexicon) OST43923 (lexicon)
OST42218 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17065
Vector Insertion
Chr 19: 24207199 - 24209339
Public Clones CMHD-GT_337A4-3 (cmhd)
Private Clones OST450016 (lexicon) OST437780 (lexicon) OST431657 (lexicon) OST424362 (lexicon)
OST404435 (lexicon) OST388736 (lexicon) OST356534 (lexicon) OST352653 (lexicon)
OST339924 (lexicon) OST339341 (lexicon) OST337992 (lexicon) OST321234 (lexicon)
OST301378 (lexicon) OST294977 (lexicon) OST287961 (lexicon) OST287723 (lexicon)
OST280753 (lexicon) OST280369 (lexicon) OST273790 (lexicon) OST244485 (lexicon)
OST232805 (lexicon) OST232583 (lexicon) OST224072 (lexicon) OST221352 (lexicon)
OST211883 (lexicon) OST209437 (lexicon) OST207247 (lexicon) OST196319 (lexicon)
OST194442 (lexicon) OST193964 (lexicon) OST192603 (lexicon) OST186218 (lexicon)
OST186021 (lexicon) OST185582 (lexicon) OST176513 (lexicon) OST150426 (lexicon)
OST147122 (lexicon) OST144329 (lexicon) OST142745 (lexicon) OST142245 (lexicon)
OST138015 (lexicon) OST108667 (lexicon) OST77280 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7624
Vector Insertion
Chr 19: 24205964 - 24207095
Public Clones XE016 (baygenomics) RRR565 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8402
Vector Insertion
Chr 19: 24200299 - 24205344
Public Clones XH251 (baygenomics) RRD001 (baygenomics) RRO266 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5496
Vector Insertion
Chr 19: 24196862 - 24199057
Public Clones CSJ332 (baygenomics)
Private Clones OST399286 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37504
Vector Insertion
Chr 19: 24188565 - 24194586
Public Clones PST16716-NR (escells) PST18008-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12056
Vector Insertion
Chr 19: 24186110 - 24187235
Public Clones A041F01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5946
Vector Insertion
Chr 19: 24185607 - 24185915
Public Clones CSH271 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11360
Vector Insertion
Chr 19: 24184301 - 24185510
Public Clones A027B01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28666
Vector Insertion
Chr 19: 24183346 - 24184220
Public Clones not available
Private Clones OST24046 (lexicon)
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5620
Vector Insertion
Chr 19: 24176488 - 24183134
Public Clones CSI593 (baygenomics) CSI812 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8877
Vector Insertion
Chr 19: 24175405 - 24176386
Public Clones XL911 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23771
Vector Insertion
Chr 19: 24170081 - 24171073
Public Clones not available
Private Clones OST245530 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099558
Sequence
GCGGGAAGCGCGCGCGAGATGCCGGTGCGGGGAGACCGCGGGTTCCCACCGCGGCGGGAGCTGTCGGGCTGGCAGCGC - UNI14315 - GGTCCAGG

CATGGAGGAGGTGATATGGGAGCAGTACACCGTGACCCTGCAGAAG - UNI14315 - - UNI15883 - GATTCCAAAAGAGGATTTGGAATTGCC

GTGTCGGGAGGCAGAGACAACCCCCACTTTGAAAATGGGGAGACGTCAATCGTCATCTCAGATGTGCTCCCAGGTGGACCCGCTGATGGCTTGCTTCA -

 UNI17065 - AGAAAATGACAGGGTGGTCATGGTCAATGGCACCCCCATGGAAGATGTGCTCCATTCGTTTGCCGTTCAGCAGCTTAGGAAAAGTGGG

AAGATAGCAGCCATC - UNI7624 - GTGGTCAAGAGACCCCGGAAGGTTCAGGTGGCCCCACTGCAAGGCAGCCCCCCTCTCAGTCATGACGACCGA

GGTTTTGAAGTGATTGAAGAATTTGATGGCAGAAGTTTCCGCAGCGGCTACAGTGAGAGGAGTCGGCACAGCAGCCACGACATGCTCAGCCACAGCTGGG

AGGGCAATAGGGAGAGGGGGCGACCCCATCAGCGCACACAGAGCCGGGAGCGGGAGCGCAGCCGTGGCAGGAGCCTGGAACGGGGCCTGGACCAGGAAGA

CTATGGGCGCAGCCGTGAGCGCAGCCGTGGCCGGAGCCTGGAGCGCGGGCTGGACCGCGACTTTGTGTCCAGGGACCACAGCCGTGGCCGTAGCATCGAC

AGGGACTACGACCGAGACTATGAGCGCTCCTATCACGAAGCTTATGAACCCGACTACGGAGGCGGCTACAGCCCATCATATGACCGTAGAGCCCATCCAG

AGACCCGCTATGAACGGAGCCGCAGCCGAGAACACCTACGTTCCCGAAGCCCCAGCCCCGAGTCTAGGTCACGGCATGAACACAAGGGCCAACATGATCC

CGACAGGCCCATCGGGGTCCTTCTAACCAAAAGCAAAGCAAATGAAG - UNI8402 - AGTATGGGCTCCGGCTGGGGAGTCAGATCTTCATCAAAGA

AATGACCAGAACAGGACTGGCCACCAAAGATGGCAACCTTCATGAGGGGGACATAATTCTCAAG ATCAACGGCACTGTTACTGAGAACATGTCTCTAAC

GGATGCTCGGAAGTTAATAGAAAAGTCTCGAGGAAAACTGCAGCTTGTGGTGTTGAGAGACAGCAAGCAGACCCTCATCAACATCCCAGCCCTAAACGAC

AGCGACTCTGAAGTGGAGG - UNI5496 - ATATCTCGGAAATAGAGTCCAACCGGTCTTTCTCTCCAGAGGAGAGACGCCAGCAGTATTCTGATCAG

GATTACCATTCCTCCACTGAGAAGCTGAAGGAGAGGCCGAG CTCAAGAGAGGAGACCTCAGGCAGACTATCCAGGATGGGTGCCACTCCCACGCCGTTC

AAGTCCACGGGGGACATCACAGCTGCGGGGGTCACAGAGGCCAGCAGGGAGCCCAGGTACCAGGAAGAAGGCCCAG TTCCTCAACCCAGAACAGCTCCA

AGAGTTTTTCTTCGTCCTAGTCCCGAAGATGAAGCAATATATGG CCCTAACACCAAAATGGTGAGGTTCAAGAAGGGAGACAGCGTGGGCCTCCGGTTG

GCTGGTGGAAACGACGTTGGGATATTTGTGGCTGGCATTCAGGAGGGCACCTCCGCAGAGCAGGAGGGCCTGCAAGAAGGAGACCAGATTCTGAAG GTG

AACACACAGGATTTCAGAGGGCTAGTCCGGGAAGATGCGGTCCTCTACCTGCTAGAAATCCCCAAAGGTGAAACTGTGACCATTTTGGCTCAGAGCCGAG

CAGACG TGTACAGAGATATCCTGGCTTGTGGCAGGGGAGATTCGTTTTTCATAAGAAGCCACTTTGAATGTGAGAAGGAAACTCCCCAGAGCCTGGCCT

TCACCAGGGGAGAGGTCTTCCGAGTGGTAGACACGCTGTACGATGGCAAGCTGGGCCACTGGCTGGCCGTGAGGATCGGGAATGAGCTGGAGAAAGGCTT

GATCCCTAACAAAAGCAG - UNI12056 - AGCCGAGCAAATGGCCAGTGTCCAGAATGCCCAGCGAGAGAACGCCGGGGACAGAGCAGACTTCTGGC

GGATGCGTGGCCAGAGATCCAGCGGCGGCGTCAAGAAGAACCTCCGCAAGAGCCGGGAAGACCTGGCGGCTGCTGTATCGGTTAGCACCAAGTTCCCTGC

CTACGAGAAGGTTCTGCTTCGGGAAG - UNI5946 - CTGGCTTCAAGAGACCCGTGGTTCTGTTTGGCCCCATAGCAGATATAGCAATGGAAAGGTT

GGCAACTGAGTTACCAGACCTGTTTCAAACTGCAA - UNI11360 - AAACAGAACCCAAAGATGCCGGATCTGAGAAATCCAGTGGAGTGGTTCGGT

TGAATACCGTGAGGCAAATTATTGAGCAG - UNI28666 - GACAAGCACGCCCTGCTCGACGTTACCCCCAAAGCTGTGGACCTGCTCAACTACACT

CAGTGGTTCCCTATCGTGATTTTCTTCAACCCGGATTCCAGACAAGGTGTTAAAACCATAAGGCAGAGGTTGAGTCCAACATCCAATAAAAGTTCTCGCA

AGTTATTTGATCAAGCCAACAAGCTCAAAAAGACCTGTTCTCATCTTTTTACAG - UNI5620 - CCACAATCAACGTGAATTCAGCCAACGATGGCT

GGTTTGGCAGCTTGAAGGACAGCATTCAGCAGCAGCAAAACGAAGCAGTCTGGGTCTCTGAAGGAAAG - UNI8877 - ATGGAAGGGATGGATGATG

ATGCTGAAGACCGCATGTCCTACTTAACCGCCATGGGCGCGGACTATCTGAGTTGTGACAGCCGTCTCATCAGTGACTTTGAAGACACCGACGGCGAGGG

AGGCGCCTACACTGACAATGAGCTAGAGGAGCCGGCGGAGGAGCCGCTGGTGTCTTCCATCACCCGCTCCTCGGAGCCGGTGCAGCACGAGGAG AACAT

AAGGAAATCCAGCCCAGAGCCACGAGCTCAGATGAGGAGGGCTGCTAGCAGAGACCAACTTAGGGATGCTAGCCCGCCCCCAGCCTTCAAGCCAGAGCCG

CCCAAG GCAAGAAGCCAGAACAGAGAAGACTCCTTCGACTACTCCAAGTCAAACCTCCCCGCCACAGCCGGCAGTGAAATCCCGGGGGGATCCACCAAA

GGCTATCCTCCCCCTATTGCAGCGAAGCCTGCCTTTGGGCGGCCCATCCTGAAGCCTTCCACTCCAGTCCCTATGCCTGAGAGCGAGGAGGTTGGAGAGA

GCACCGAGGAGCAGGAAGATGCTCCCAGATCAGTCCTGGGCAGAGTGAAAATATTCGAGAAGATGGACCACAAGGCAAAATTACAGAGGATGCAGGAGCT

CCAGGAGGCCCAGAATGCGAGG ATCGAAATAGCTCAGAAGCACCCTGACATCTATGCGGTTCCAATCAAGGCCCCCAAGCCAGATGCTGGCCTCCCCCC

GCACATGAG - UNI23771 - TTCTAGACCCCCAGAGCCCCAGAAAGCTCCTTCCAGACTTTACCAGGACACCAGAGGAAGCTACGGCAGTGACCCCG

AGGAGGAGGAGTACCGCCAGCAGTTGGCAGCACACTCGAAGCGTGGTTACTACAGCCAGCCCTCCCGGTACCGAGACACGGAGTTATAGAGCTTGTATGC

GTGGACTCCTGCGAGGCCACCTGGAGATCTTCTCCAGTTAAAACGCACTGCAGAGATACGGTGGGGACCCAGGCAACAGATGGCATGAGTTATCAACTGA

AGGCTCTGTTTGTGGGACTGGAGTGAAGTTGATTCTGACTTTCTTGAATGAAGAGAAACAGTCTGATAACTGTTACTTGCTTTGGTGTGGACCAAGATCT

GTATTAACCTCTCTGTATTTTTTAATATGTATATCGAGCAATAACTATCTTTCCTCACTCGTGGCTGCCTTCCTGCACAGCTTCAGTGTGAAGCAGATGT

GAAGAGGGAGTTAAAAAAAAAAAAAAAAAAAGGACTCCGTCTCAGACTAAGTTCAGAAGTATTTTATCACGACTCTCTAAGTGCCTTTGACAAAATGTGT

CTCACGTTTGCCTCCCTCCCTGACGCTTCATGCAAACCCATAATGGACTAAAACTTTATTTTGACTAAATTTTTATACCAGTTTAGCAGCTGTGACTGCC

CCTGCACCATGCCACCTTTTCAGGGCATTGTCTGTAGTATTTTCCACAAATTCTGACTGTACATAGGACAGCGACCCTCGGGAGTGTGTCTGCCTATCAA

TTCTGCGTAGCTCGGAGGCCAAGATTTTAGAGTGTTTGTCCGTTGTCTGGAACCACATATTCCACAAAGGCAGAGACTTGAGAAAAGGGTATTTTGTTTC

CTCTCTATCAGAGTATGTACTGACATCGGGTGGTTTTGTAATTT
Translation
 - UNI14315 - MEEVIWEQYTVTLQK - UNI14315 - - UNI15883 - DSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQ -

 UNI17065 - QENDRVVMVNGTPMEDVLHSFAVQQLRKSGKIAAI - UNI7624 - VVKRPRKVQVAPLQGSPPLSHDDRGFEVIEEFDGRSFRSG

YSERSRHSSHDMLSHSWEGNRERGRPHQRTQSRERERSRGRSLERGLDQEDYGRSRERSRGRSLERGLDRDFVSRDHSRGRSIDRDYDRDYERSYHEAYE

PDYGGGYSPSYDRRAHPETRYERSRSREHLRSRSPSPESRSRHEHKGQHDPDRPIGVLLTKSKANEE - UNI8402 - EYGLRLGSQIFIKEMTRTGL

ATKDGNLHEGDIILK INGTVTENMSLTDARKLIEKSRGKLQLVVLRDSKQTLINIPALNDSDSEVED - UNI5496 - DISEIESNRSFSPEERRQQ

YSDQDYHSSTEKLKERPS SSREETSGRLSRMGATPTPFKSTGDITAAGVTEASREPRYQEEGPV VPQPRTAPRVFLRPSPEDEAIYG GPNTKMVRFK

KGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILK VNTQDFRGLVREDAVLYLLEIPKGETVTILAQSRADV VYRDILACGRGDSFFIRSHF

ECEKETPQSLAFTRGEVFRVVDTLYDGKLGHWLAVRIGNELEKGLIPNKSR - UNI12056 - RAEQMASVQNAQRENAGDRADFWRMRGQRSSGGVK

KNLRKSREDLAAAVSVSTKFPAYEKVLLREA - UNI5946 - AGFKRPVVLFGPIADIAMERLATELPDLFQTAK - UNI11360 - KTEPKDAGS

EKSSGVVRLNTVRQIIEQ - UNI28666 - DKHALLDVTPKAVDLLNYTQWFPIVIFFNPDSRQGVKTIRQRLSPTSNKSSRKLFDQANKLKKTCSHL

FTA - UNI5620 - ATINVNSANDGWFGSLKDSIQQQQNEAVWVSEGK - UNI8877 - MEGMDDDAEDRMSYLTAMGADYLSCDSRLISDFEDTD

GEGGAYTDNELEEPAEEPLVSSITRSSEPVQHEE NIRKSSPEPRAQMRRAASRDQLRDASPPPAFKPEPPK ARSQNREDSFDYSKSNLPATAGSEIPG

GSTKGYPPPIAAKPAFGRPILKPSTPVPMPESEEVGESTEEQEDAPRSVLGRVKIFEKMDHKAKLQRMQELQEAQNAR IEIAQKHPDIYAVPIKAPKPD

AGLPPHMS - UNI23771 - SSRPPEPQKAPSRLYQDTRGSYGSDPEEEEYRQQLAAHSKRGYYSQPSRYRDTEL

For any suggestions or comments, please send an email to unitrap@crg.es