Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024831 (Ighmbp2)
Chromosomal location
Chr 19: 3259364 - 3282979 (-)
Description
immunoglobulin mu binding protein 2 Gene [Source:MGI (curated);Acc:Ighmbp2-001]
RefSeq_dna
NM_009212 
RefSeq_peptide
NP_033238.2 
UniGene
Mm.397321 Mm.3179 
MGI
MGI:99954 
Uniprot/SWISSPROT
P40694 
Human Ortholog
ENSG00000132740 (IGHMBP2)
Omim 604320 - SPINAL MUSCULAR ATROPHY, DISTAL, AUTOSOMAL RECESSIVE, 1  
UniTrap UNI29595
Vector Insertion
Chr 19: 3281418 - 3282907
Public Clones (sanger) E140H12 (ggtc) E140G12 (ggtc) IST14556H5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6816
Vector Insertion
Chr 19: 3267337 - 3268297
Public Clones RHA105 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000119292
Sequence
GATCCTACTGCAATCACTGGCTTGGCGGGGAACGCAGGAAACGGACCGGCCGGGAATCCGCGCCCTGGCTGGGAGCGCAGGGCCTTTTGCGGATTCTGGT

CCAGTGGGGAACACGGTCCGACTGGAACTCGGGTCCCACAGGACTAAACTGGCCGAGCAGGAAGCATCAGTCAGGGGCTGCATCGCGGAGCAGATGGCCT

CGTCCACCGTGGAGAGTTTCGTGGCCCAGCAGCTACAGCTGCTGGAGCTGGAGCGGGACGCCGAGGTGGAGGAGCGCAG - UNI29595 - GTCCTGG

CAGGAACACAGTTCTCTGAGAGAGCTTCAGAGCCGAGGGGTGTGCTTGCTGAAGCTTCAGGTATCCAGCCAGCGCACAGGGCTGTATGGGCAGCGGCTGG

TCACCTTTGAGCCCAGGAAGTTTGGACCTGCAGTGGTGCTTCCTAGCAACAGCTTCACCTCTG - UNI29595 - GTGATATTGTGGGTCTGTATGAT

ACTAATGAAAACAGTCAACTGGCCACTGGGGTCCTGACCCGAATCACCCAAAAATCAGTCACAGTGGCTTTTGATGAGTCCCATGATCTCCAGCTGAACC

TGGACAGAGAGAATACCTACAGACTGCTGAAGCTTGCCAACGATGTCACCTACAAACGCCTGAAAAA AGCACTGATGACACTGAAGAAGTACCACTCTG

GGCCAGCATCCTCCCTCATAGACATCCTGTTGGGCAGCTCCACCCCAAGTCCTGCCATGGAAATAC CCCCACTCTCTTTCTACAACACAACTCTGGACC

TTTCCCAGAAAGAAGCTGTGTCCTTTGCACTGGCCCAGAAAGAACTTGCCATCATCCATGGGCCTCCTGGCACTGGGAAAACCACAACTGTGGTGGAAAT

AATCCTTCAAGCTGTGAAGCAAGGCTTAAAG GTCCTGTGCTGTGCTCCCTCCAACATCGCTGTGGACAACCTGGTGGAGCGTCTGGCTCTGTGCAAGAA

GCGGATTCTGCGCCTGGGTCACCCCGCCCGCCTCCTGGAGTCCGTTCAGCACCACTCACTGGATGCAGTGCTAGCACGCAGTGACAACGCCCAGATTGTT

GCTGACATCAGAAGGGACATAGACCAGGTCTTT GGCAAGAACAAAAAGACGCAGGATAAGAGAGAGAAAGGTAATTTTCGAAGTGAAATTAAGCTGCTA

AGGAAGGAACTGAAGGAGAGGGAAGAAGCAGCCATAGTTCAGAGCCTCACTGCGGCAGATGTGGTTCTAGCCACCAACACAG GTGCATCGTCTGATGGC

CCTCTGAAGCTGCTGCCTGAGGACTACTTTGATGTGGTGGTGGTGGACGAATGTGCCCAGGCCCTAGAAGCCAGCTGCTGGATCCCCCTGCTGAAGGCCC

CAAAGTGCATCCTAGCTGGGGACCACAGACAGCTGCCACCCACCACCGTCTCTCACAG GGCGGCACTGGCTGGGCTGTCCCGCAGCCTGATGGAGCGTC

TGGCAGAGAAGCATGGTGCTGGTGTGGTGAGGATGCTGACGGTACAGTACCGAATGCACCAGGCCATCATGTGCTGGGCCTCGGAGGCCATGTACCACGG

GCAGCTTACTTCCCATCCCTCTGTGGCAGGACACCTCCTGAA GGACCTCCCAGGCGTGACTGACACAGAGGAGACACGTGTCCCGCTGCTGCTCATAGA

CACCGCTGGCTGTGGGCTTCTGGAGCTGGAGGAGGAGGACAGCCAGTCCAAGGGAAATCCGG - UNI6816 - GCGAAGTTCGCCTCGTCACTTTGCA

CATCCAGGCTCTGGTGGATGCTGGGGTCCAGGCAGGTGACATTGCCGTCATCGCACCCTACAACCTTCAG GTGGATCTGCTCAGACAGAGCCTCTCCAA

CAAGCACCCTGAGCTGGAGATTAAGTCTGTTGATGGCTTTCAAGGCCGAGAGAAAGAGGCTGTGCTCCTGACCTTTGTCAGGTCCAATAGGAAAG GTGA

AGTTGGTTTTCTGGCTGAGGACAGGCGGATTAATGTTGCTGTTACCCGTGCTCGGCGGCACGTGGCAGTCATCTGTGATTCCCACACTGTCAACAACCAT

GCTTTTTTGAAGACCTTGGTGGATTATTTCACAGAGCATGGGGAGGTACGCACAGCCTTTGAATACCTGGATGACATCGTCCCTGAGAACTACACCCATG

AGGGTTCCCAGGGCCACAGCCGTGTCCCCAAACCCAAGTGCCCCAGCACCTCCATCAGGAAGCCTGCCAGTGATCAGGAGAGTGGCCAGGAGACCAGAGC

AGCCCCTAGACATGGCCGCAGGAAGCCAAGCGAGAAGCCCCCGGGCTCTCACGTCCAGTCCCAGCACAGCTCCAGTGCAAATGGCTCTGACAGAACTGGA

GGCCCAGACCGGACAGAGCACTTTAGGGCTACGATTGAGGAGTTTGTGGCTAGCAAGGAGTCCCAGTTGGAGTTTCCCACATCCCTGAGTTCCCATGACA

GGCTGCGAGTCCACCAGTTAGCTGAGGAGTTCGGGCTGAGGCACGACAGCACCGGGGAGGGGAAGGCTCGGCACATCACAGTGAGCAGGAGGAGCCCTGC

CAGCTCTGGCAGTGTAGCCCCACAGCCTTCCTCACCGCCCAGCCCTGCACAGGCTGAGCCTGAGCCTCGGGCAGAGGAGCCCGTCACCGTCGTGCAGGCA

CATTGCCCTGTACAGCTGGATCTGAAGGCACTGCATCTGGAGAGGCTGCAGCGGCAGCAAAGCTCCCAGGCTCAGACAGCCAAGGGTCAGCCAGGTGGGG

ACTCGAGGCCACAGAAGGCTTCACAGAAGAAAAAGAAAAAAGAACCAAAAG ATCCACGGCTGTGGAGAAAAGGCTCGTGCCCATGCCCGCCAGAGGATT

AGCCGGGAAGGAGTGCTGTATGCAGGCAGTGGGACCAAGGACAGGGCCCTGGACCCGGCCAAGAGGGCCCAGCTGCAGAGGAGGCTGGACAAGAAGCTGG

GCGAGCTCAGCAGCCAGAGGACAAGCAGGAAGAAGGAGAAGGAGAGGGGGACATGAAGCCACACCCTCAGGGAGGGCTGTGTGGGACAGAGGCAGCAGGT

GGGGACACGGTCCTACACTGGCCATTTCTCTGCTTGAGCTAGTGTGCCCCTAGTCCTCCCATGGCAAGGGTGCTGTTTGTGAGGAGATGCGCCTAGTTAC

CATCAGAGTAACTGCCTTGCCTGGCCAGGCCCCATTGATGCTTTGAGTGCCTTGCATGGCCAGCTAGCCATGGCCACCGTCATCCTGTCTTCTGCAGTGA

CACAGTGGGCATGGATTGTGTGGTCTAGGGATGCGGGAATGGCTGTACGGGCTCCTAGTCTGTAATGGCCTGGCCTCTGCTGCTTGGTGACTGGTGGGAA

GTAGTCCTTCCAGGGCCCCATACACTGCTCACCCTCAGAGACTGCACCCTCGCCAGCACTCTGTACCTGTTGCTCATGGGAACTTTGACAGATGCAATTT

AGCCTCAGGCTCTTGTTCCAAAATAATATAAATTATTTGCAAATTAAAGTGTACACACAGTGGA
Translation
MASSTVESFVAQQLQLLELERDAEVEERR - UNI29595 - RSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRLVTFEPRKFGPAVVLPSNSFTS

G - UNI29595 - GDIVGLYDTNENSQLATGVLTRITQKSVTVAFDESHDLQLNLDRENTYRLLKLANDVTYKRLKK KALMTLKKYHSGPASSLIDI

LLGSSTPSPAMEIP PPLSFYNTTLDLSQKEAVSFALAQKELAIIHGPPGTGKTTTVVEIILQAVKQGLK VLCCAPSNIAVDNLVERLALCKKRILRLG

HPARLLESVQHHSLDAVLARSDNAQIVADIRRDIDQVF GKNKKTQDKREKGNFRSEIKLLRKELKEREEAAIVQSLTAADVVLATNTG GASSDGPLKL

LPEDYFDVVVVDECAQALEASCWIPLLKAPKCILAGDHRQLPPTTVSHR RAALAGLSRSLMERLAEKHGAGVVRMLTVQYRMHQAIMCWASEAMYHGQL

TSHPSVAGHLLK KDLPGVTDTEETRVPLLLIDTAGCGLLELEEEDSQSKGNPG - UNI6816 - GEVRLVTLHIQALVDAGVQAGDIAVIAPYNLQ 

VDLLRQSLSNKHPELEIKSVDGFQGREKEAVLLTFVRSNRKG GEVGFLAEDRRINVAVTRARRHVAVICDSHTVNNHAFLKTLVDYFTEHGEVRTAFEY

LDDIVPENYTHEGSQGHSRVPKPKCPSTSIRKPASDQESGQETRAAPRHGRRKPSEKPPGSHVQSQHSSSANGSDRTGGPDRTEHFRATIEEFVASKESQ

LEFPTSLSSHDRLRVHQLAEEFGLRHDSTGEGKARHITVSRRSPASSGSVAPQPSSPPSPAQAEPEPRAEEPVTVVQAHCPVQLDLKALHLERLQRQQSS

QAQTAKGQPGGDSRPQKASQKKKKKEPKD DPRLWRKGSCPCPPED
Transcript ENSMUST00000025751
Sequence
AGCGCAGGGCCTTTTGCGGATTCTGGTCCAGTGGGGAACACGGTCCGACTGGAACTCGGGTCCCACAGGACTAAACTGGCCGAGCAGGAAGCATCAGTCA

GGGGCTGCATCGCGGAGCAGATGGCCTCGTCCACCGTGGAGAGTTTCGTGGCCCAGCAGCTACAGCTGCTGGAGCTGGAGCGGGACGCCGAGGTGGAGGA

GCGCAG - UNI29595 - GTCCTGGCAGGAACACAGTTCTCTGAGAGAGCTTCAGAGCCGAGGGGTGTGCTTGCTGAAGCTTCAGGTATCCAGCCAGC

GCACAGGGCTGTATGGGCAGCGGCTGGTCACCTTTGAGCCCAGGAAGTTTGGACCTGCAGTGGTGCTTCCTAGCAACAGCTTCACCTCTG - UNI2959

5 - GTGATATTGTGGGTCTGTATGATACTAATGAAAACAGTCAACTGGCCACTGGGGTCCTGACCCGAATCACCCAAAAATCAGTCACAGTGGCTTTTG

ATGAGTCCCATGATCTCCAGCTGAACCTGGACAGAGAGAATACCTACAGACTGCTGAAGCTTGCCAACGATGTCACCTACAAACGCCTGAAAAA AGCAC

TGATGACACTGAAGAAGTACCACTCTGGGCCAGCATCCTCCCTCATAGACATCCTGTTGGGCAGCTCCACCCCAAGTCCTGCCATGGAAATAC CCCCAC

TCTCTTTCTACAACACAACTCTGGACCTTTCCCAGAAAGAAGCTGTGTCCTTTGCACTGGCCCAGAAAGAACTTGCCATCATCCATGGGCCTCCTGGCAC

TGGGAAAACCACAACTGTGGTGGAAATAATCCTTCAAGCTGTGAAGCAAGGCTTAAAG GTCCTGTGCTGTGCTCCCTCCAACATCGCTGTGGACAACCT

GGTGGAGCGTCTGGCTCTGTGCAAGAAGCGGATTCTGCGCCTGGGTCACCCCGCCCGCCTCCTGGAGTCCGTTCAGCACCACTCACTGGATGCAGTGCTA

GCACGCAGTGACAACGCCCAGATTGTTGCTGACATCAGAAGGGACATAGACCAGGTCTTT GGCAAGAACAAAAAGACGCAGGATAAGAGAGAGAAAGGT

AATTTTCGAAGTGAAATTAAGCTGCTAAGGAAGGAACTGAAGGAGAGGGAAGAAGCAGCCATAGTTCAGAGCCTCACTGCGGCAGATGTGGTTCTAGCCA

CCAACACAG GTGCATCGTCTGATGGCCCTCTGAAGCTGCTGCCTGAGGACTACTTTGATGTGGTGGTGGTGGACGAATGTGCCCAGGCCCTAGAAGCCA

GCTGCTGGATCCCCCTGCTGAAGGCCCCAAAGTGCATCCTAGCTGGGGACCACAGACAGCTGCCACCCACCACCGTCTCTCACAG GGCGGCACTGGCTG

GGCTGTCCCGCAGCCTGATGGAGCGTCTGGCAGAGAAGCATGGTGCTGGTGTGGTGAGGATGCTGACGGTACAGTACCGAATGCACCAGGCCATCATGTG

CTGGGCCTCGGAGGCCATGTACCACGGGCAGCTTACTTCCCATCCCTCTGTGGCAGGACACCTCCTGAA GGACCTCCCAGGCGTGACTGACACAGAGGA

GACACGTGTCCCGCTGCTGCTCATAGACACCGCTGGCTGTGGGCTTCTGGAGCTGGAGGAGGAGGACAGCCAGTCCAAGGGAAATCCGG - UNI6816 

- GCGAAGTTCGCCTCGTCACTTTGCACATCCAGGCTCTGGTGGATGCTGGGGTCCAGGCAGGTGACATTGCCGTCATCGCACCCTACAACCTTCAG GT

GGATCTGCTCAGACAGAGCCTCTCCAACAAGCACCCTGAGCTGGAGATTAAGTCTGTTGATGGCTTTCAAGGCCGAGAGAAAGAGGCTGTGCTCCTGACC

TTTGTCAGGTCCAATAGGAAAG GTGAAGTTGGTTTTCTGGCTGAGGACAGGCGGATTAATGTTGCTGTTACCCGTGCTCGGCGGCACGTGGCAGTCATC

TGTGATTCCCACACTGTCAACAACCATGCTTTTTTGAAGACCTTGGTGGATTATTTCACAGAGCATGGGGAGGTACGCACAGCCTTTGAATACCTGGATG

ACATCGTCCCTGAGAACTACACCCATGAGGGTTCCCAGGGCCACAGCCGTGTCCCCAAACCCAAGTGCCCCAGCACCTCCATCAGGAAGCCTGCCAGTGA

TCAGGAGAGTGGCCAGGAGACCAGAGCAGCCCCTAGACATGGCCGCAGGAAGCCAAGCGAGAAGCCCCCGGGCTCTCACGTCCAGTCCCAGCACAGCTCC

AGTGCAAATGGCTCTGACAGAACTGGAGGCCCAGACCGGACAGAGCACTTTAGGGCTACGATTGAGGAGTTTGTGGCTAGCAAGGAGTCCCAGTTGGAGT

TTCCCACATCCCTGAGTTCCCATGACAGGCTGCGAGTCCACCAGTTAGCTGAGGAGTTCGGGCTGAGGCACGACAGCACCGGGGAGGGGAAGGCTCGGCA

CATCACAGTGAGCAGGAGGAGCCCTGCCAGCTCTGGCAGTGTAGCCCCACAGCCTTCCTCACCGCCCAGCCCTGCACAGGCTGAGCCTGAGCCTCGGGCA

GAGGAGCCCGTCACCGTCGTGCAGGCACATTGCCCTGTACAGCTGGATCTGAAGGCACTGCATCTGGAGAGGCTGCAGCGGCAGCAAAGCTCCCAGGCTC

AGACAGCCAAGGGTCAGCCAGGTGGGGACTCGAGGCCACAGAAGGCTTCACAGAAGAAAAAGAAAAAAGAACCAAAAG GTCCAGTTATGGCTCTGCCCT

GTGAGGAGGACTTCGACGCCCTGGTGTCTGCTGTGGTGAAGGCTGACAACACCTGTAGCTTCTCCAAGTGCTCGGCCAGCACCACCACTCTGGGCCAGTT

CTGCATGCACTGTAGCCACCGCTACTGCCTCAGCCACCATCTGCCTGAA ATCCACGGCTGTGGAGAAAAGGCTCGTGCCCATGCCCGCCAGAGGATTAG

CCGGGAAGGAGTGCTGTATGCAGGCAGTGGGACCAAGGACAGGGCCCTGGACCCGGCCAAGAGGGCCCAGCTGCAGAGGAGGCTGGACAAGAAGCTGGGC

GAGCTCAGCAGCCAGAGGACAAGCAGGAAGAAGGAGAAGGAGAGGGGGACATGAAGCCACACCCTCAGGGAGGGCTGTGTGGGACAGAGGCAGCAGGTGG

GGACACGGTCCTACACTGGCCATTTCTCTGCTTGAGCTAGTGTGCCCCTAGTCCTCCCATGGCAAGGGTGCTGTTTGTGAGGAGATGCGCCTAGTTACCA

TCAGAGTAACTGCCTTGCCTGGCCAGGCCCCATTGATGCTTTGAGTGCCTTGCATGGCCAGCTAGCCATGGCCACCGTCATCCTGTCTTCTGCAGTGACA

CAGTGGGCATGGATTGTGTGGTCTAGGGATGCGGGAATGGCTGTACGGGCTCCTAGTCTGTAATGGCCTGGCCTCTGCTGCTTGGTGACTGGTGGGAAGT

AGTCCTTCCAGGGCCCCATACACTGCTCACCCTCAGAGACTGCACCCTCGCCAGCACTCTGTACCTGTTGCTCATGGGAACTTTGACAGATGCAATTTAG

CCTCAGGCTCTTGTTCCAAAATAATATAAATTATTTGCAAATTAAAGTGTACACACAGTGGATATTTGCTTGTGTTGGAGGTGAGCATTCTTTCCTTCTG

GCCCAGATGTCACCCTGTACATGCTGTGACTGGGTAGTGGTAGCACCTCCCCAGGGCATCCAATCGTGATGACAGCCTGGCATCATGGACAGGCATGGGA

GCAGATGTGGGCACTTGAGGAAAGACACTGGCTCTTGTTGCACTGGAGGCTAGTGACCACTCTGCCCGCCTTCTAGAAACCCCTCTGTAGAAGAAAAGGA

AGCCAAAGAGAAACAAATAAGGCTGCAGGTTGACCTGGTGATATTATCCTGGAGTCTCTGGATCCAGCCACGCTTCATCTCCAACTCATCCTTTCCAGCA

TTCTTTAGAATTAAGTCCTTTTTTTTGGCTGAACAAAGTCCACGTTGGGTTTCTGTCACTTGCTGCCAAAGATTCTTTGCTGATCCAGTTGTGCCTGCAG

CTGTATATCTTATTAAAGCATGTTTTTGTTTGAGGGGGGAGGTGTGCATACTTGGAGAGGTCAGCATGTGTGTGGGAGTCAAGCCGCCAGCAGCCATCAG

GCCTCTCCTTCCATGGTGTGGTCCCAGGAATCACTCGGGTCTTCAGGCTCGGTGGCAGTACCTGCTACATCTGGCTTTTCTACGTGGGTGCTGGGGATCT

GAACTCGGGTTCTCCTGTTTGAATGGCAAGTGGTTTGCCTACTCAGCTGTTTCCCCAGCCCAGCACATCTGCTCTTGCACAGGGTCTGCACTGCCCTTAC

ACAGGGTCTGCGTCCTGGCATGGAGATTGTGCTGAACCAGAGTCCCTGGCCACTGGGGAGAGACGAGGTCTCGGATTGCCACTGGGAGCAGCTCCCATGT

GTGGTCCAAAGCACAGTGGAAGATTGACCTTGCCATTCCTGGAAGTGAGCATGTGTGGTTTGGGCCCCTGCACACGGGTCTTCACGCCTGTAGTGTGCCT

TTGGGTCCCACAAGCCCTGTCCTGGATGTTCCCCACCCTGACTGTTGCTTCGTTAAAATGCTGGATTCCAAGTTTGTGTTTCCCATCCCAGAGAACTCTC

ATTAGGAAAATGTGTCTGATTGCTTGAAAAATGTCTTATGGCCTCCCTCAGACAGCATGCTCTACAGTGTGCCTCCCTCAGATACCATGCTCTACAGTGT

GCCTCCCTCAGACACCATGCTCTATAGTGTGCCTTCCTCAGATACCATGCTCAAGCCTTCACAGGACCAAGGGCCTCTCCTCCCATTGATGTCCAACAAG

GTCATCCTCTACTTCATGTGTGGCTGGAGTGTTTGTTCCCTCCAAGTGTACTCTTTGGTTCATGGTTTAGTTCCTGGGAAATCTGGGGGTAGTGTTCATA

CTGTTGTTCCTCCTATAGGGTTGCAAACCACTTCAGCTTCTTTGGTCCCCTCTCAAACTCCTCCATTGGGGACTTTGTGCTCAGTCTAATGGTTGGGGGC

AAGCATCTACCTCTGTATTTGTCAGGCACCGATAGAACCTTTCAGGAGACTGTTATATCAGACTCCCATCATCAAGTACTTGTTGGCATCCACAATAGTG

TCTGGGTTTGGTAACTATATGA
Translation
MASSTVESFVAQQLQLLELERDAEVEERR - UNI29595 - RSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRLVTFEPRKFGPAVVLPSNSFTS

G - UNI29595 - GDIVGLYDTNENSQLATGVLTRITQKSVTVAFDESHDLQLNLDRENTYRLLKLANDVTYKRLKK KALMTLKKYHSGPASSLIDI

LLGSSTPSPAMEIP PPLSFYNTTLDLSQKEAVSFALAQKELAIIHGPPGTGKTTTVVEIILQAVKQGLK VLCCAPSNIAVDNLVERLALCKKRILRLG

HPARLLESVQHHSLDAVLARSDNAQIVADIRRDIDQVF GKNKKTQDKREKGNFRSEIKLLRKELKEREEAAIVQSLTAADVVLATNTG GASSDGPLKL

LPEDYFDVVVVDECAQALEASCWIPLLKAPKCILAGDHRQLPPTTVSHR RAALAGLSRSLMERLAEKHGAGVVRMLTVQYRMHQAIMCWASEAMYHGQL

TSHPSVAGHLLK KDLPGVTDTEETRVPLLLIDTAGCGLLELEEEDSQSKGNPG - UNI6816 - GEVRLVTLHIQALVDAGVQAGDIAVIAPYNLQ 

VDLLRQSLSNKHPELEIKSVDGFQGREKEAVLLTFVRSNRKG GEVGFLAEDRRINVAVTRARRHVAVICDSHTVNNHAFLKTLVDYFTEHGEVRTAFEY

LDDIVPENYTHEGSQGHSRVPKPKCPSTSIRKPASDQESGQETRAAPRHGRRKPSEKPPGSHVQSQHSSSANGSDRTGGPDRTEHFRATIEEFVASKESQ

LEFPTSLSSHDRLRVHQLAEEFGLRHDSTGEGKARHITVSRRSPASSGSVAPQPSSPPSPAQAEPEPRAEEPVTVVQAHCPVQLDLKALHLERLQRQQSS

QAQTAKGQPGGDSRPQKASQKKKKKEPKG GPVMALPCEEDFDALVSAVVKADNTCSFSKCSASTTTLGQFCMHCSHRYCLSHHLPE IHGCGEKARAHA

RQRISREGVLYAGSGTKDRALDPAKRAQLQRRLDKKLGELSSQRTSRKKEKERGT

For any suggestions or comments, please send an email to unitrap@crg.es