Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024844 (Banf1)
Chromosomal location
Chr 19: 5364641 - 5366631 (-)
Description
barrier to autointegration factor 1 Gene [Source:MGI Symbol;Acc:MGI:1346330]
RefSeq_peptide
NP_001033320.1 NP_035923.1 
UniGene
Mm.455515 
MGI
MGI:1346330 
Uniprot/SWISSPROT
O54962 
Human Ortholog
ENSG00000175334 (BANF1)
Omim not available
UniTrap UNI10457
Vector Insertion
Chr 19: 5365957 - 5366567
Public Clones (sanger) D038D06 (ggtc) P063A07 (ggtc) P133A02 (ggtc) D055G04 (ggtc)
PST11216-NR (escells) PSTVU01.F35 (vanderbilt)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11948
Vector Insertion
Chr 19: 5365159 - 5365817
Public Clones (sanger) D070H08 (ggtc) D077H06 (ggtc) D056C05 (ggtc) Q001C01 (ggtc)
D077G04 (ggtc) CMHD-GT_331D8-3 (cmhd) CMHD-GT_434C6-3 (cmhd) CMHD-GT_543H9-3 (cmhd)
CMHD-GT_381H9-3 (cmhd) CMHD-GT_466C7-3 (cmhd) CMHD-GT_146C10-3 (cmhd) CMHD-GT_417C9-3 (cmhd)
CMHD-GT_473C1-3 (cmhd) CMHD-GT_393A2-3 (cmhd) CMHD-GT_471H2-3 (cmhd) PST3682-NR (escells)
PST17990-NR (escells) PST10308-NR (escells) PSTVUpb16f7 (vanderbilt) IST12151A12 (tigm)
IST13643B10 (tigm) IST10730A9 (tigm) IST14519H1 (tigm)
Private Clones OST425768 (lexicon) OST389402 (lexicon) OST385877 (lexicon) OST364960 (lexicon)
OST338506 (lexicon) OST336470 (lexicon) OST267159 (lexicon) OST262895 (lexicon)
OST256023 (lexicon) OST237797 (lexicon) OST232726 (lexicon) OST224442 (lexicon)
OST204759 (lexicon) OST185854 (lexicon) OST183968 (lexicon) OST171086 (lexicon)
OST138511 (lexicon) OST102324 (lexicon) OST81681 (lexicon) OST81160 (lexicon)
OST26453 (lexicon)
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025762
Sequence
GCTTGAGGTCTGGGCGGGAGCGGCCGAGTGGCGCGAGGAGCCGTTACCAGAGCCGGAGCCTCCG - UNI10457 - GTTAAGCCTGATCACGATGACA

ACCTCCCAAAAGCACCGAGACTTCGTGGCAGAGCCCATGGGGGAAAAGCCAGTGGGGAGCCTGGCCGGGATTGGTGACGTCCTGAGCAAGAGGCTGGAGG

AAAGGGGCTTTGACAAG - UNI11948 - GCTTATGTGGTCCTTGGCCAGTTTCTGGTGCTAAAGAAAGATGAAGACCTCTTCCGAGAATGGCTGAAG

GATACATGTGGTGCCAATGCCAAGCAGTCCCGGGACTGCTTTGGGTGCCTTCGAGAATGGTGTGATGCCTTCTTGTAGTGTTCTCTGGGGATCCCTCATA

CCCCAGCCACAGCACAGTTTCCAGAGTCTGCAGCAGGGCAGGGCTCCTCCCTGTCCTCCATAAAGGAAAAGATGGCTGTTGTCACCCTCACCTCCTATGT

ACTCCAGGGTCTATGGGGAGTTCTCTCCCCTCAGCGTTTCAATCTTTCTGGGATCGTTTCCCTTGCATGCCTTTCCCTTCCACCTCCCCCTGCAGTTCCG

TGGCAGCAGTTACCAACTTTCCTGAATGGATTCCTGGCCCCCTTCTCCCTCACTATCTGTTGGATGCCCTTTGGCTCCTTTCCTTTTTTTGGCAAAAACA

GTCACTGTCCTTATAAAAGATTTTTAAATTAATAAAATCAGTGGCCTTC
Translation
 - UNI10457 - MTTSQKHRDFVAEPMGEKPVGSLAGIGDVLSKRLEERGFDK - UNI11948 - AYVVLGQFLVLKKDEDLFREWLKDTCGANAK

QSRDCFGCLREWCDAFL

For any suggestions or comments, please send an email to unitrap@crg.es