Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024853 (Sf3b2)
Chromosomal location
Chr 19: 5273935 - 5295411 (-)
Description
splicing factor 3b, subunit 2 Gene [Source:MGI Symbol;Acc:MGI:2441856]
RefSeq_dna
NM_030109 
RefSeq_peptide
NP_084385.1 
UniGene
Mm.196532 
MGI
MGI:2441856 
Uniprot/SPTREMBL
Q3UAI4 Q3UBH2 Q3UJB0 Q3UQU5 Q80W39 Q8BL33 Q9CS24 
Human Ortholog
ENSG00000087365 (SF3B2)
Omim not available
UniTrap UNI21659
Vector Insertion
Chr 19: 5294377 - 5295040
Public Clones CMHD-GT_499G12-3 (cmhd)
Private Clones OST322831 (lexicon) OST7395 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37413
Vector Insertion
Chr 19: 5293079 - 5294377
Public Clones PST23007-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37150
Vector Insertion
Chr 19: 5291423 - 5293079
Public Clones CMHD-GT_477C7-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14969
Vector Insertion
Chr 19: 5288303 - 5291423
Public Clones PST13684-NR (escells) PST996-1 (escells) PSTVU01.HO38 (vanderbilt)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7053
Vector Insertion
Chr 19: 5275164 - 5279268
Public Clones RRY476 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27126
Vector Insertion
Chr 19: 5274528 - 5274791
Public Clones not available
Private Clones OST69021 (lexicon) OST67450 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025774
Sequence
GCCTTCTTGTGGCTAAGATGGCGGCGGAGCATCCCGAACCTCCCAAAGGAGAGTTGCAGTTGCCACCGCCTCCACCTCCAGGCCACTATGGAGCCTGGGC

TGCGCAGGAGCTTCAGGCCAGATTGGCAGAGATAGGAGCGCCGATCCAGG GGAGTCGCGAGGAGTTAGTAGAGCGGCTGCAGACCTACACCCGTCAG -

 UNI21659 - ACGGGCATTGTCCTGAATCGACCAGTTTTGAGAGGAGAAGATGGGGACAAAGCGGCTCCTCCTCCTATGTCAGCACAG CTGTCTGGG

ATTCCTATGCCACCACCACCTATGGGACTTCCCCCTCTACAGCCTCCTCCACCACCTCCACCACCTCCACCAGGCCTTGGCCTTGGCTTTCCTATGGCTC

ACCCACCAAATCTGGGGCCCCCACCACCTCTTCGAGTGGGTGAGCCTGTGGCGCTGTCAGAAGAAGAACGGCTGAAGCTGGCACAGCAGCAGGCAGCTTT

GCTGATGCAGCAAGAGGAGCGTGCCAAGCAG - UNI14969 - GCAGCTGTGTTAATGGAGCAGGAACGGCAGCAGGAGATCGCCAAGATGGGCACTG

CAGTCCCTCGGCCGCCTCAGGATATGGGGCAGCTGGGTGTCCGTACTCCTCTGGGGCCTCGCG - UNI14969 - TAGCTGCTCCAGTAGGCCCTGTG

GTTCCCACGCCTACGGTTTTGCCCATGGGGGCACCTGTTCCTCGCCCTCGGGGTCCCCCCCCACCCCCTGGAGATGAGAACAGAGAG - UNI14969 -

 ATGGATGATCCTTCTGTGGGCCCCAAGATCCCCCAGGCTTTGGAAAAGATTCTTCAGCTGAAGGAGAGCCGGCAGGAAGAGATGAACTCTCAGCAGG A

GGAGGAGGAAATGGAGACAGATACTCGCTCATCTCTGGGACAGTCAGCATCAGAGACTGAGGAGGACACGGTGTCCATATCCAAAAAAGAG AAAAACCG

AAAGCGTCGGAACCGAAAGAAGAAGAAAAAGCCACAGCGGGTGCGGGCAGCCTCATCAGAGAGCTCTGGGGACCGAGAGAAGGACTCCGGTCGGTCCCGC

GGCTCGGACCCCCCTGCTGCTGACGTGGAGATTGAGTATGTGACCGAGGAGCCTGAGATCTACGAGCCCAATTTCATCTTCTTCAAGAGGATTTTTGAGG

CTTTCAAG CTAACTGATGATGTGAAGAAGGAAAAAGAAAAGGAGCCAGAGAAGCTTGACAAGATGGAGAGCTCTGCAGTCCCCAAGAAGAAGGGCTTTG

AGGAGGAGCACAAGGACAGTGACGATGACAGCAGTGATGATGAGCAG GAAAAGAAGCCGGAAGCCCCTAAACTGTCGAAGAAGAAGTTGCGCCGAATGA

ATCGTTTTACTGTGGCAGAACTCAAGCAG CTGGTGGCCCGGCCTGATGTTGTGGAGATGCATGACGTGACGGCACAGGACCCCAAGCTCTTGGTCCACC

TCAAGGCCACCCGGAACTCCGTCCCTGTGCCACGCCACTGGTGTTTTAAGCGCAAGTACCTTCAAGGCAAACGGGGCATTGAGAAGCCCCCCTTTGAGCT

GCCAGACTTCATCAAACGCACAGGCATTCAGGAAATGAGAGAGGCCCTGCAGGAGAAG GAAGAACAAAAAACCATGAAGTCAAAAATGAGAGAGAAGGT

TCGGCCGAAGATGGGGAAGATCGACATTGACTACCAGAAGCTACACGATGCCTTCTTCAAGTGGCAGACCAAGCCGAAACTCACCATCCATGGGGACCTT

TATTATGAG GGGAAGGAGTTTGAGACACGGCTGAAGGAGAAGAAGCCTGGAGATTTATCTGATGAGCTAAGGATTTCCTTAGGAATGCCAGTAGGACCT

 AATGCCCACAAAGTCCCTCCTCCGTGGCTGATTGCCATGCAGCGATACGGGCCACCCCCATCCTACCCAAACCTGAAAATCCCTGGACTGAATTCACCT

ATCCCTGAG AGCTGCTCCTTTGGATACCATGCTGGTGGCTGGGGCAAACCCCCAGTGGATGAGACTGGGAAGCCGCTCTATGGGGACGTGTTTGGAACC

AATGCTGCTGAGTTTCAG ACCAAAACGGAAGAAGAAGAAATTGACCGGACCCCGTGGGGGGAACTGGAACCATCTGATGAAGAATCCTCAGAAGAGGAG

GAGGAGGAGGAAAGCGATGAAGACAAGCCAGATGAGACTGGCTTCATCACACCTGCAGACAG CGGCCTCATCACTCCCGGAGGATTCTCATCCGTGCCA

GCTGGGATGGAGACCCCTGAACTCATTGAGCTGAGGAAGAAGAAGATCGAAGAGGCGATGGATGG - UNI7053 - AAGTGAGACACCTCAGTTATTC

ACTGTATTGCCAGAGAAGAGAACAGCCACTGTTGGGGGAGCCATGATGGGATCCACCCACATTTATGACATGTCCACG GTTATGAGCCGGAAGGGCCCA

GCCCCTGAATTGCAAGGTGTGGAAGTAGCGCTGGCGCCTGAGGAATTGGAGTTGGACCCCATGGCCATGACGCAGAAGTACGAGGAGCACGTTCGGGAGC

AGCAGGCACAAGTAGAGAAGGAAGACTTCAGCGACATGGTGGCTGAGCATGCTGCTAAGCAGAAG - UNI27126 - CAAAAGAAACGGAAAGCTCAG

CCCCAGGACAGCCGTGGGGGCAGCAAGAAATACAAGGAGTTCAAATTTTAGGTCCTGCTCGCATAGCTGGCCTGCCTTTAGGCTCTTTGTATGTCTGGGC

TTTCTCTGTGGCTCCCTAAAGCTAGATCTGGACTCCCTAGGCTCGTCACTTCCTGTTCTTATTTTAGACTTGTTTTGTAAATAAAGCTGTTTCCCAAGGA

AGGATGAATACAGGCGCTCTTGAACCTCTCTCTCTTTTAGCTTCTGCAAAAGCATCTACTTCTTGCCTGTAATCACAGATGGCCCATAGGACTATGGGAC

TGTAGTTCTGAACTGAACTTGTGGGTAGTTCACTATCCCTACCCCTCCTGTGTGTGAAGGCTCTGCTGAAGGTACCTTTGGGTCTGGTCTGACCTTACTG

CTTTGTCCGTGGGGAATAAAAATAGCCAGCTTAGCACCGTGGCTAGGCTGGGAAGTAACTGTAGGCTAGGGAAGTAGGCCAGGTCAGGCCTTCCTCATTG

ACCTTGTGGCAGAAAGGCCGATTTCTTACCTATTGGAGAACATCTGTCTCTAAATAAAATCTCAATTGTTCC
Translation
MAAEHPEPPKGELQLPPPPPPGHYGAWAAQELQARLAEIGAPIQG GSREELVERLQTYTRQ - UNI21659 - TGIVLNRPVLRGEDGDKAAPPPMS

AQ LSGIPMPPPPMGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQ - UNI14969 - AAV

LMEQERQQEIAKMGTAVPRPPQDMGQLGVRTPLGPRV - UNI14969 - VAAPVGPVVPTPTVLPMGAPVPRPRGPPPPPGDENRE - UNI14969 

- MDDPSVGPKIPQALEKILQLKESRQEEMNSQQE EEEEMETDTRSSLGQSASETEEDTVSISKKE KNRKRRNRKKKKKPQRVRAASSESSGDREKDS

GRSRGSDPPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFK LTDDVKKEKEKEPEKLDKMESSAVPKKKGFEEEHKDSDDDSSDDEQ EKKPEAPKLSKK

KLRRMNRFTVAELKQ LVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEK EEQKTMK

SKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYE GKEFETRLKEKKPGDLSDELRISLGMPVGP NAHKVPPPWLIAMQRYGPPPSYPNL

KIPGLNSPIPE SCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQ TKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADS SG

LITPGGFSSVPAGMETPELIELRKKKIEEAMDG - UNI7053 - GSETPQLFTVLPEKRTATVGGAMMGSTHIYDMST VMSRKGPAPELQGVEVALA

PEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQK - UNI27126 - QKKRKAQPQDSRGGSKKYKEFKF

For any suggestions or comments, please send an email to unitrap@crg.es