Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024855 (Pacs1)
Chromosomal location
Chr 19: 5133688 - 5273119 (-)
Description
phosphofurin acidic cluster sorting protein 1 Gene [Source:MGI Symbol;Acc:MGI:1277113]
RefSeq_dna
NM_153129 
RefSeq_peptide
NP_694769.2 
UniGene
Mm.234923 
MGI
MGI:1277113 
Uniprot/SWISSPROT
Q8K212 
Uniprot/SPTREMBL
Q3TAB8 Q3TP27 
Human Ortholog
ENSG00000175115 (PACS1)
Omim not available
UniTrap UNI20948
Vector Insertion
Chr 19: 5168012 - 5272538
Public Clones D118E11 (ggtc) D176G03 (ggtc) (ggtc) D102H07 (ggtc) CMHD-GT_539F12-5S (cmhd)
CMHD-GT_539E12-5S (cmhd) CMHD-GT_539E12-3S (cmhd) IST12252F2 (tigm)
IST11618F1 (tigm) IST10664A2 (tigm) IST14904C5 (tigm) IST13486C9 (tigm)
IST12010E8 (tigm) IST12643B6 (tigm) IST13203D6 (tigm)
Private Clones OST347654 (lexicon) OST213859 (lexicon) OST133741 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1528
Vector Insertion
Chr 19: 5160808 - 5167923
Public Clones CC0553 (sanger) CMHD-GT_511E3-3 (cmhd) CMHD-GT_335A7-3 (cmhd) CMHD-GT_485F9-3 (cmhd)
CMHD-GT_539E12-3 (cmhd)
Private Clones OST107399 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8105
Vector Insertion
Chr 19: 5160094 - 5160717
Public Clones RRG074 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7861
Vector Insertion
Chr 19: 5145187 - 5147126
Public Clones RRP202 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025786
Sequence
CGCCCACCCAGTGTCTGGGCCTCGCGGGCCGCAACAGGCGGCGGCGGGCGAGCGCGAGGACCGCGCGCAGCGAAAGCCCGCGCGTGCGTGCAGATTCGCT

GGTGGCTCGCGCTCCGCCGGGCGTTCTGAGGAGACGCGCTGAGCCGCTGCCGCCGCGGGGGGAAGCCTGAGAGTCGCTCGCGTGCCCTCAGTCTGCGTAA

GCCCCGCGCCCCTTCCTCCCCTGGCCAGGCCATGGCGGAACGCGGAGGGGCGGGCGGTGGTCCCGGAGGCTCCGGGGGCGGCAGCAGTCAGCGGGGCTCT

GGGGTCGCCCAGTCCCCGCAGCAGCAGCCGCAGCAGCAGCCGCCGCAGCCTCAACAGCCGACGCCCCCCAAGCTGGCCCAGGCCACCTCGTCCTCCTCGT

CCACCTCGGCTGCGGCCGCCTCCTCCTCGTCCTCCTCCACCTCCACCTCCATGGCCGTCGCGGTGGCCTCGGGCTCTGCGCCTCCGGGCGGTCCAGGACC

AGGCCGCACCCCCGCCCCAGTGCAGATGAATTTGTATGCTACCTGGGAGGTGGACCGGAGCTCATCCAGCTGCGTGCCCAG - UNI20948 - GCTCT

TCAGCTTAACTCTGAAGAAACTTGTTATGCTTAAAGAAATGGACAAAGATCTTAACTCAGTAGTCATTGCTGTGAAGCTGCAG - UNI1528 - GGTT

CAAAAAGGATTCTTCGCTCCAATGAGATCATCCTTCCAGCCAGTGGCCTGGTGGAGACAGAGCTCCAGTTAACCTTCTCCCTCCAG - UNI8105 - T

ACCCTCATTTCCTTAAGCGAGATGCCAACAAACTGCAGATTATGTTGCAAAGGAGGAAGCGGTACAAGAACCGAACTATCTTGGGCTATAAAACCTTAGC

TGTGGGACTCATCAACATGGCAGAG GTGATGCAACACCCTAATGAGGGCGCTTTAGTACTTGGCCTGCACAGCAATGTGAAGGATGTCTCTGTGCCAGT

GGCAGAAATAAAAATCTACTCTTTATCCAGCCAGCCCATTGACCATGAAGGAATCAAGTCTAAGCTGTCTG ATCGCTCCCCAGATATTGACAACTACTC

TGAAGAAGAGGAGGAAAGCTTCTCCTCAGAGCAGGAAGGCAGTGACGACCCATTGCATGGGCAG GACCTATTCTATGAAGATGAAGATCTTCGGAAAGT

AAAGAAGACTCGGAGGAAACTGACCTCAACCTCAGCCATCACTAGG CAACCTAACATCAAACAGAAGTTTGTGGCCCTCCTGAAACGATTCAAAGTTTC

TGACGAG GTGGGCTTTGGGCTAGAACACGTGTCCCGGGAGCAGATTCGGGAAGTGGAGGAGGACTTGGATGAACTGTACGACAGTCTAGAGATGTACAA

CCCCAGCGACAGTGGCCCTGAGATGGAGGAAACAGAAAGCATCCTCAGCACCCCAAAGCCCAAGCTCAA GCCCTTCTTTGAGGGGATGTCTCAGTCCAG

CTCACAGACGGAGATTGGCAGTCTCAACAGCAAGGGCAGCCTCGGGAAAGACACCACCAGTCCT ATGGAGTTGGCTGCTTTAGAAAAAGTCAAATCTAC

CTGGATTAAAAACCAAGATGACAGCTTGACTGAAACAGACACTTTA - UNI7861 - GAAATCACTGACCAGGACATGTTTGGAGATGTGAGCACAAG

TCTGGTTGTACCAGAAAAAGTCAAAACTCCTATGAAGTCCAGCAAAGCTGATCTGCAGGGCTCTGCCTCTCCCAG CAAGGTGGAAGGGACACACACACC

TCGGCAGAAGAGGAGCACTCCCCTGAAGGAGCGACAGCTCTCCAAGCCCCTGAGTGAGAGAACCAACAGCTCTGACAGTGAGCGATCTCCTGATCTGGGC

CACAGCACACAG ATTCCAAGGAAGGTGGTATACGACCAACTGAATCAGATCCTGGTATCGGATGCAGCCCTCCCTGAAAATGTCATCCTGGTGAACACC

ACAGACTGGCAGGGCCAG TACGTGGCTGAATTGCTTCAAGACCAGAGGAAGCCTGTGGTATGCACCTGCTCAACAGTGGAGGTCCAGGCAGTGCTGTCC

GCCCTTCTCACTAGGATTCAGCGCTA CTGCAACTGCAACTCATCCATGCCGAGGCCGGTCAAGGTGGCAGCTGTGGGCAGCCAGAGCTACCTGAGCTCC

ATCCTCCGTTTTTTTGTCAAGTCCCTTGCCAGCAAGACCCCAGACTGGCTGGGTTACATGCGCTTCCTCATCATTCCCCTAG GTTCTCATCCAGTGGCC

AAATACTTGGGCTCAGTAGATAGTAGATATAGCAGCACCTTTCTTGATTCTGCCTGGAGAGACCTATTCAGTCGCTCAGAGCCTCCAGTGTCAG AGCCA

CTGGACGTGGTGGGTCGTGTGATGCAGTATGTCAATGGAGCTACCACAACACACCAGCTGCCTGTGGCTGAAGCCATGTTGACCTGCAGGCATAAGTT C

CCTGATGAGGACTCCTACCAGAAGTTCATCCCCTTCATTGGC GTTGTGAAAGTGGGCCTTGTTGAAGACTCGCCCTCCACTGCAG GTGATGGGGACGA

TTCACCTGTGGTCAGCCTTACTGTGCCCTCCACATCACCACCCTCAAGCTCAGGCCTGAGCCGAGATGCCACAGCTACCCCTCCCTCGTCCCCATCCATG

AGCAGTGCCCTCGCCATCGTGGG GAGCCCAAATAGCCCATATGGGGATGTGATTGGTCTCCAGGTGGACTACTGGCTGGGCCACCCTGGGGAGCGAAGG

AGAGAAGGTGATAAGAGGGATGCCAGCTCAAAGAACACCCTCAAGAGTGTCTTCCGCTCGGTGCAGGTTTCTCGCCTGCCACATGCAGGGGAAGCCCAGC

TTTCTGGCACCATGGCAATGACTGTGGTCACCAAAGAGAAGAACAAGAAAG TGCCCACTATCTTCCTGAGCAAGAAGCCCCGAGAAAAGGAGGTGGATT

CTAAGAGCCAGGTCATCGAGGGCATCAGCCGCCTCATCTGTTCTGCAAAGCAGCAGCAAACCATGCTGAGAG TGTCCATCGATGGAGTTGAGTGGAGTG

ACATCAAGTTCTTCCAGCTGGCAGCCCAGTGGCCAACTCATGTCAAGCACTTTCCAGTGGGACTCTTCAGTGGCAGCAAGACCACCTGAGACCCTGCCTC

CCAACCACTCCCTCCTGGCACTGCCACCCAGCCTCACCACCTGCAGGCAGGGGAAGGCCAGCAAGCCCCAGCCCAGCCTCCCTTTCCCAGCACTGGGGCT

TGTCTCTACACACCCAGTCCTAAAGGACACTGCCACTGGGGATACAGCCCTCCCCTCTCACTGCCCAGCCCATCTCTGGACTACCCTTCCTCCTGTTCCA

GGCCCAGAGCTGGGTGGTCCTGACTCTGGTACCCATAATCCCTGTAATTGAATACTCTGGGCCTTCCTTCACCTCACTCACCCCTGCAGCACTGGTACCC

TTTCTGGAAATGAAAAACCTGGAGTTCTGGTACAGTGAGACAGCCCAGCACCCTACATAGCCTGGCCACCTGGCTCTGCATTTCCAAGGCTCTGTTGCCT

GTTGTACTCCCCCTGCCTTCCTCCAGCAGGGCTGGGGCCTCCTACCCTTCCTGTGACCTCACCTGCCGCGCAACTTCCCAGTAGGGGGAATGAGGCTGGC

ACCTGGGCATCCCGGTATTTCTGGGATTGAAGGGGCCTTCCCAGTCTCTCCCATGCATGATTTCCTGGCATCTCAAATCACTTGGATGTCCTGTGTTTTG

TGTGTGTTTTAGTTGTTTGGGTAACTTGTCCTGTGCACAGGTCCTTGAGGCTCCTCCCTCTGCCTCCCAGCCTCCCACCTAAGATTGTTCTGTGGCTTCA

TGAGGTAGGAGACAGCAAACCCACCCCTCCACATACATTATCTGTGACTCTTACCCAGTCATATGTCTCCCTTTTCCTGTGTCAGCTTGCGTCCCCATCC

CTGCTTTGTCTTCCCACTTCTGTCATGGCAGGGCAGCAGAAAGAGGCCCATCTCCACCAGGTCTCCCTCCAGCAGCCTCCTTCCCTCTCTCAGCCATGGA

TGGGTCCCAGACCTATCTCAGCCTCCTCATCAGTGTCTTCATGAGAGGCTGAGGACACGTGACAGAGCTAGCCCAGCCTCCATGCCCTCTGGCACTTCAG

AGCTTCTCTGTTGCCCTCTCACTGCTTCCTAGCAGTGTGGCACAGAACTGCACTCAGAACATAGTTTTGGCATTCTTCACATCCAAGACTCCAGCCCTTC

CTGCTGCCCAGCCCTACTGTCCAGAGTGTCTCTTGGGCCTGAGAATAAGTGGGGTGGGAAGACTGGGGCCATGTTGGGTTTTTTCATTCAATAAACTGGT

GATTTCTTACC
Translation
MAERGGAGGGPGGSGGGSSQRGSGVAQSPQQQPQQQPPQPQQPTPPKLAQATSSSSSTSAAAASSSSSSTSTSMAVAVASGSAPPGGPGPGRTPAPVQMN

LYATWEVDRSSSSCVPR - UNI20948 - RLFSLTLKKLVMLKEMDKDLNSVVIAVKLQ - UNI1528 - GSKRILRSNEIILPASGLVETELQLT

FSLQ - UNI8105 - YPHFLKRDANKLQIMLQRRKRYKNRTILGYKTLAVGLINMAE VMQHPNEGALVLGLHSNVKDVSVPVAEIKIYSLSSQPIDH

EGIKSKLSD DRSPDIDNYSEEEEESFSSEQEGSDDPLHGQ DLFYEDEDLRKVKKTRRKLTSTSAITR QPNIKQKFVALLKRFKVSDE VGFGLEHVS

REQIREVEEDLDELYDSLEMYNPSDSGPEMEETESILSTPKPKLK KPFFEGMSQSSSQTEIGSLNSKGSLGKDTTSP MELAALEKVKSTWIKNQDDSL

TETDTL - UNI7861 - EITDQDMFGDVSTSLVVPEKVKTPMKSSKADLQGSASPS SKVEGTHTPRQKRSTPLKERQLSKPLSERTNSSDSERSPDL

GHSTQ IPRKVVYDQLNQILVSDAALPENVILVNTTDWQGQ YVAELLQDQRKPVVCTCSTVEVQAVLSALLTRIQRY YCNCNSSMPRPVKVAAVGSQS

YLSSILRFFVKSLASKTPDWLGYMRFLIIPLG GSHPVAKYLGSVDSRYSSTFLDSAWRDLFSRSEPPVSE EPLDVVGRVMQYVNGATTTHQLPVAEAM

LTCRHKF FPDEDSYQKFIPFIG VVKVGLVEDSPSTAG GDGDDSPVVSLTVPSTSPPSSSGLSRDATATPPSSPSMSSALAIVG GSPNSPYGDVIGL

QVDYWLGHPGERRREGDKRDASSKNTLKSVFRSVQVSRLPHAGEAQLSGTMAMTVVTKEKNKKV VPTIFLSKKPREKEVDSKSQVIEGISRLICSAKQQ

QTMLRV VSIDGVEWSDIKFFQLAAQWPTHVKHFPVGLFSGSKTT

For any suggestions or comments, please send an email to unitrap@crg.es