Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024858 (Adrbk1)
Chromosomal location
Chr 19: 4286002 - 4306222 (-)
Description
adrenergic receptor kinase, beta 1 Gene [Source:MGI Symbol;Acc:MGI:87940]
RefSeq_dna
NM_130863 
RefSeq_peptide
NP_570933.1 
MGI
MGI:87940 
Uniprot/SWISSPROT
Q99MK8 
Uniprot/SPTREMBL
Q3U5J8 Q7TS64 Q3U1V3 
Human Ortholog
ENSG00000173020 (ADRBK1)
Omim not available
UniTrap UNI19447
Vector Insertion
Chr 19: 4294849 - 4294927
Public Clones not available
Private Clones OST391013 (lexicon) OST313521 (lexicon) OST230379 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36505
Vector Insertion
Chr 19: 4294849 - 4305194
Public Clones (ggtc) IST14529E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13770
Vector Insertion
Chr 19: 4292841 - 4294849
Public Clones CMHD-GT_267F8-3 (cmhd) IST13354H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24663
Vector Insertion
Chr 19: 4292646 - 4292766
Public Clones not available
Private Clones OST210879 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025791
Sequence
CAAGGCCACGCCGGCCGCGCGCGCCAGCAAGAAGATCCTGCTGCCAGAGCCCAG - UNI36505 - GGGACCTCCCATCCTACAGCAGATGGACCATG

CTGCCACCTCTCTACAAGACAACTGATGTCATCGCACCTG - UNI19447 - - UNI36505 - CATCCGCAGCGTCATGCAGAAGTATCTGGAGGA

CCGAGGAGAAGTGACCTTTGAAAAGATCTTTTCGCAGAAGTTAG - UNI13770 - - UNI19447 - - UNI36505 - GGTACCTGCTTTTCCG

GGACTTCTGCCTGAACCATCTGGAAGAGGCCAAGCCCTTGGTGGAGTTCTACGAAGAG - UNI24663 - ATCAAGAAATATGAGAAGCTGGAGACAG

AGGAGGAACGTGTGGTCCGCAGCCGAGAGATCTTTGACTCCTATATTATGAAAGAACTGCTGGCCTGCTCACAT CCCTTTTCAAAGAATGCTACGGAGC

ATGTCCAGGGCCACCTGGTGAAGAAGCAGGTGCCTCCAGATCTCTTCCAG CCATACATTGAGGAGATTTGTCAGAACCTCCGAGGGGACGTGTTCCAGA

AGTTCATAGAGAG TGACAAGTTCACACGGTTCTGCCAGTGGAAGAATGTTGAGCTCAACATCCAC CTGACCATGAATGACTTCAGTGTGCATCGAATC

ATCGGGCGTGGGGGCTTCGGTGAGGTCTATGGGTGCCGGAAAGCAGACACAGGCAAGAT GTACGCCATGAAGTGTCTGGACAAGAAACGCATCAAGATG

AAGCAGGGAGAGACCCTGGCTCTGAACGAGCGGATCATGCTTTCCCTCGTCAGCACCGGG GACTGCCCCTTCATCGTGTGCATGTCATATGCATTCCAC

ACACCAGACAAGCTCAGCTTCATCCTGGACCTCATGAACG GTGGGGACCTGCACTACCACCTGTCTCAGCATGGAGTCTTCTCTGAAGCCGACATGCGC

TTCTACGCCGCTGAGATCATCCTGGGCCTTGAACACATGCACAATCGCTTTGTAGTCTACAGGGACCTGAAG CCAGCCAACATTCTCCTGGATGAACAT

GGCCATGTGAGAATCTCGGACCTGGGCCTAGCCTGTGACTTCTCCAAGAAGAGGCCTCATGCCAGTGT GGGCACACACGGGTACATGGCCCCCGAAGTC

CTACAGAAGGGCGTGGCCTATGACAGCAGTGCAGACTGGTTCTCCCTGGGCTGCATGCTCTTCAAGTTGTTGCGGGG ACACAGCCCCTTCCGGCAGCAC

AAGACCAAAGACAAGCATGAGATTGACCGCATGACGTTGACGATG GCTGTAGAGCTGCCTGACTCCTTCTCCCCTGAACTCCGATCCCTGCTGGAAGGT

TTGTTGCAGAGGGACGTCAATCGGAGACTAGGCTGTCTGGGCCGTGG GGCTCAGGAGGTAAAAGAAAGTCCTTTCTTTCGTTCCCTGGACTGGCAGATG

GTCTTCTTACAGAAG TACCCTCCTCCACTGATCCCCCCACGTGGGGAGGTGAATGCAGCTGACGCTTTCGACATTGGCTCCTTTGATGAGGAGGACACA

AAAGGAATCAAG TTACTGGACAGTGACCAGGAACTGTACCGCAACTTCCCTCTCACCATCTCTGAGCGGTGGCAACAGGAGGTGGCAGAGACTGTCTTT

GATACCATCAATGCTGAAACAGACCGGCTGGAGGCACGAAAGAAGGCCAAAAACAAACAGCTGGGCCACGAGGAGG ACTATGCCCTGGGTAAGGACTGC

ATCGTGCATGGCTACATGTCCAAGATGGGCAACCCCTTCCTGACCCAGTGGCAGCGGCGATACTTCTACTTGTTCCCCAACCGGCTCGAGTGGAGGGGTG

AAGGCGAGGCTCCG CAGAGCCTCCTGACCATGGAGGAGATCCAGTCAGTGGAAGAGACACAGATCAAGGAACGCAAGTGTCTCCTGCTTAAGATCCGAG

GTGGCAAGCAGTTTGTCCTGCAGTGTGAT AGTGATCCAGAGCTGGTGCAATGGAAAAAGGAGCTGCGTGATGCCTACCGCGAGGCCCAGCAGCTGGTAC

AGCGAGTACCCAAGATGAAGAACAAGCCACGCTCGCCTGTGGTGGAGCTGAGCAAGGTGCCGCTGATCCAGCGTGGCAGTGCCAACGGCCTCTGATCCAC

CCATGTGCTGCCCGCCTGCCCACCCGCCTTTTATAAACCTCTAATTTATTTTGTTGAATTTTTATTATTTGTTTTCCCGCAAAGCGGAAAATGTTTTATT

TTGTAATTATTGTGATCTCCTGTGGCCCCAGCCTGGCCCAGCCCCCAGGGAGGGGCCCGCTTGCCTCAGCTCCTGCTGCCACCAACCCAGCCACTGTCTA

GCACCCCTCCCCTGTCCCCACTCCCACCCCCTAGGGTCCTTGCTCCCAGTATCTTCCTACAGGGAAGAAGAGCAACCCTCAGCAGCCCTCTTGCCCCTCC

ATGGGGTGAAGCCACACTCAGTGGGTGTGTCACTTCAGGCTCTGTGGGCTGTGCTCAGTCTGTGGCCCAGCACCCCTGCCCTAGAAAGGGGCAACACAGG

GTACTACTTGAACTTTCCTATCACAGCTCCCATGCCACAGAGGGACAGACCCCTGCTGTCCTGCCCTCTTGCCACTGGTGAGAGAAGGCCCTTGTCTCCT

CAGACTAGGAGGTCTCCCACAGTGACAGCTCCTGGGTCCTTGTTCAGGAAAAGCCTGTGTGTTACCACTGCCTCATCAGGAGGCTGCCATTGGCAGTGGC

TGCTGCTGGCCTCCCTGCAAGTCCCCTCTTCTTCCTGTTGCGTGCCTGGACTCAGGAGCATAGAAAAGACAATTGTGGATTGGGCCACACTGGCCTAGCC

TGAACCTAGATCCCTAACCCTGGGCTGGGTGAGGCTCACCTGCCCAGGACCACAGTGGGACAGCCTGGGCAGGTGGGTGGCACAGCATAAGAACCCAGCT

GGGGCCAGCCCTCCCTGTCCTGGCTGGTCAGTGTGCCCCCACCCACACTGTCCAGCCCCTTAGCCCATGTCATGTCAGTGGCCACTGCCCACAGGTGCCA

CCTTGCCCACCGCATGACCCCTTGTGCCAGTCGCGCAGCTGTGTGTGGTGTCGCGCCCTCTCCCCTTGGGGGCTGGGTGGGCACACCCTCCCCTCTTGTC

TACTCACTCCTAGGGCGTTTCTTTGCCGATTTTTGAATGTGATTTTAAAGAGTGGAAAATGAGACTATGCGTTTTTATAAAAAATGGTGCCTG
Translation
 - UNI36505 -  - UNI19447 - - UNI36505 - MQKYLEDRGEVTFEKIFSQKLG - UNI13770 - - UNI19447 - - UNI36505

 - GYLLFRDFCLNHLEEAKPLVEFYEE - UNI24663 - IKKYEKLETEEERVVRSREIFDSYIMKELLACSH PFSKNATEHVQGHLVKKQVPPDL

FQ PYIEEICQNLRGDVFQKFIES SDKFTRFCQWKNVELNIH LTMNDFSVHRIIGRGGFGEVYGCRKADTGKM MYAMKCLDKKRIKMKQGETLALNE

RIMLSLVSTG DCPFIVCMSYAFHTPDKLSFILDLMNG GGDLHYHLSQHGVFSEADMRFYAAEIILGLEHMHNRFVVYRDLK PANILLDEHGHVRISD

LGLACDFSKKRPHASV VGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRG GHSPFRQHKTKDKHEIDRMTLTM AVELPDSFSPELRSLLEGLLQ

RDVNRRLGCLGRG GAQEVKESPFFRSLDWQMVFLQK YPPPLIPPRGEVNAADAFDIGSFDEEDTKGIK LLDSDQELYRNFPLTISERWQQEVAETVF

DTINAETDRLEARKKAKNKQLGHEED DYALGKDCIVHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAP QSLLTMEEIQSVEETQIKERKCLLLK

IRGGKQFVLQCD SDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLIQRGSANGL
Transcript ENSMUST00000113837
Sequence
AGTCCCGGCGGGAGCGGAGCGCGAGCCGGGCCGGGCCCGAGCCGGCGCCATGGGGCGGCGCCGCCTGTGAGCCGGCGACGAGCGAGGACCGGGCGGGGCG

GCGGCGGCGCCGAGGCCCACAAGCCGCGCGGGCCGGGCCGGGCCGAGCGAGCGGGAGCGGAGCGGAGCCTCGGGCGGCGGGAGGAACAGCGCCGCCGCCG

CCGCCAAGATGGCCGACCTGGAGGCGGTGCTGGCCGATGTGAGCTACCTGATGGCCATGGAGAAGAGCAAGGCCACGCCGGCCGCGCGCGCCAGCAAGAA

GATCCTGCTGCCAGAGCCCAG - UNI19447 - - UNI36505 - CATCCGCAGCGTCATGCAGAAGTATCTGGAGGACCGAGGAGAAGTGACCTTT

GAAAAGATCTTTTCGCAGAAGTTAG - UNI13770 - - UNI19447 - - UNI36505 - GGTACCTGCTTTTCCGGGACTTCTGCCTGAACCAT

CTGGAAGAGGCCAAGCCCTTGGTGGAGTTCTACGAAGAG - UNI24663 - ATCAAGAAATATGAGAAGCTGGAGACAGAGGAGGAACGTGTGGTCCG

CAGCCGAGAGATCTTTGACTCCTATATTATGAAAGAACTGCTGGCCTGCTCACAT CCCTTTTCAAAGAATGCTACGGAGCATGTCCAGGGCCACCTGGT

GAAGAAGCAGGTGCCTCCAGATCTCTTCCAG CCATACATTGAGGAGATTTGTCAGAACCTCCGAGGGGACGTGTTCCAGAAGTTCATAGAGAG TGACA

AGTTCACACGGTTCTGCCAGTGGAAGAATGTTGAGCTCAACATCCAC CTGACCATGAATGACTTCAGTGTGCATCGAATCATCGGGCGTGGGGGCTTCG

GTGAGGTCTATGGGTGCCGGAAAGCAGACACAGGCAAGAT GTACGCCATGAAGTGTCTGGACAAGAAACGCATCAAGATGAAGCAGGGAGAGACCCTGG

CTCTGAACGAGCGGATCATGCTTTCCCTCGTCAGCACCGGG GACTGCCCCTTCATCGTGTGCATGTCATATGCATTCCACACACCAGACAAGCTCAGCT

TCATCCTGGACCTCATGAACG GTGGGGACCTGCACTACCACCTGTCTCAGCATGGAGTCTTCTCTGAAGCCGACATGCGCTTCTACGCCGCTGAGATCA

TCCTGGGCCTTGAACACATGCACAATCGCTTTGTAGTCTACAGGGACCTGAAG CCAGCCAACATTCTCCTGGATGAACATGGCCATGTGAGAATCTCGG

ACCTGGGCCTAGCCTGTGACTTCTCCAAGAAGAGGCCTCATGCCAGTGT GGGCACACACGGGTACATGGCCCCCGAAGTCCTACAGAAGGGCGTGGCCT

ATGACAGCAGTGCAGACTGGTTCTCCCTGGGCTGCATGCTCTTCAAGTTGTTGCGGGG ACACAGCCCCTTCCGGCAGCACAAGACCAAAGACAAGCATG

AGATTGACCGCATGACGTTGACGATG GCTGTAGAGCTGCCTGACTCCTTCTCCCCTGAACTCCGATCCCTGCTGGAAGGTTTGTTGCAGAGGGACGTCA

ATCGGAGACTAGGCTGTCTGGGCCGTGG GGCTCAGGAGGTAAAAGAAAGTCCTTTCTTTCGTTCCCTGGACTGGCAGATGGTCTTCTTACAGAAG TAC

CCTCCTCCACTGATCCCCCCACGTGGGGAGGTGAATGCAGCTGACGCTTTCGACATTGGCTCCTTTGATGAGGAGGACACAAAAGGAATCAAG TTACTG

GACAGTGACCAGGAACTGTACCGCAACTTCCCTCTCACCATCTCTGAGCGGTGGCAACAGGAGGTGGCAGAGACTGTCTTTGATACCATCAATGCTGAAA

CAGACCGGCTGGAGGCACGAAAGAAGGCCAAAAACAAACAGCTGGGCCACGAGGAGG ACTATGCCCTGGGTAAGGACTGCATCGTGCATGGCTACATGT

CCAAGATGGGCAACCCCTTCCTGACCCAGTGGCAGCGGCGATACTTCTACTTGTTCCCCAACCGGCTCGAGTGGAGGGGTGAAGGCGAGGCTCCG CAGA

GCCTCCTGACCATGGAGGAGATCCAGTCAGTGGAAGAGACACAGATCAAGGAACGCAAGTGTCTCCTGCTTAAGATCCGAGGTGGCAAGCAGTTTGTCCT

GCAGTGTGAT AGTGATCCAGAGCTGGTGCAATGGAAAAAGGAGCTGCGTGATGCCTACCGCGAGGCCCAGCAGCTGGTACAGCGAGTACCCAAGATGAA

GAACAAGCCACGCTCGCCTGTGGTGGAGCTGAGCAAGGTGCCGCTGATCCAGCGTGGCAGTGCCAACGGCCTCTGATCCACCCATGTGCTGCCCGCCTGC

CCACCCGCCTTTTATAAACCTCTAATTTATTTTGTTGAATTTTTATTATTTGTTTTCCCGCAAAGCGGAAAATGTTTTATTTTGTAATTATTGTGATCTC

CTGTGGCCCCAGCCTGGCCCAGCCCCCAGGGAGGGGCCCGCTTGCCTCAGCTCCTGCTGCCACCAACCCAGCCACTGTCTAGCACCCCTCCCCTGTCCCC

ACTCCCACCCCCTAGGGTCCTTGCTCCCAGTATCTTCCTACAGGGAAGAAGAGCAACCCTCAGCAGCCCTCTTGCCCCTCCATGGGGTGAAGCCACACTC

AGTGGGTGTGTCACTTCAGGCTCTGTGGGCTGTGCTCAGTCTGTGGCCCAGCACCCCTGCCCTAGAAAGGGGCAACACAGGGTACTACTTGAACTTTCCT

ATCACAGCTCCCATGCCACAGAGGGACAGACCCCTGCTGTCCTGCCCTCTTGCCACTGGTGAGAGAAGGCCCTTGTCTCCTCAGACTAGGAGGTCTCCCA

CAGTGACAGCTCCTGGGTCCTTGTTCAGGAAAAGCCTGTGTGTTACCACTGCCTCATCAGGAGGCTGCCATTGGCAGTGGCTGCTGCTGGCCTCCCTGCA

AGTCCCCTCTTCTTCCTGTTGCGTGCCTGGACTCAGGAGCATAGAAAAGACAATTGTGGATTGGGCCACACTGGCCTAGCCTGAACCTAGATCCCTAACC

CTGGGCTGGGTGAGGCTCACCTGCCCAGGACCACAGTGGGACAGCCTGGGCAGGTGGGTGGCACAGCATAAGAACCCAGCTGGGGCCAGCCCTCCCTGTC

CTGGCTGGTCAGTGTGCCCCCACCCACACTGTCCAGCCCCTTAGCCCATGTCATGTCAGTGGCCACTGCCCACAGGTGCCACCTTGCCCACCGCATGACC

CCTTGTGCCAGTCGCGCAGCTGTGTGTGGTGTCGCGCCCTCTCCCCTTGGGGGCTGGGTGGGCACACCCTCCCCTCTTGTCTACTCACTCCTAGGGCGTT

TCTTTGCCGATTTTTGAATGTGATTTTAAAGAGTGGAAAATGAGACTATGCGTTTTTATAAAAAATGGTGCCTG
Translation
 - UNI19447 - - UNI36505 - MQKYLEDRGEVTFEKIFSQKLG - UNI13770 - - UNI19447 - - UNI36505 - GYLLFRDFCLN

HLEEAKPLVEFYEE - UNI24663 - IKKYEKLETEEERVVRSREIFDSYIMKELLACSH PFSKNATEHVQGHLVKKQVPPDLFQ PYIEEICQNLR

GDVFQKFIES SDKFTRFCQWKNVELNIH LTMNDFSVHRIIGRGGFGEVYGCRKADTGKM MYAMKCLDKKRIKMKQGETLALNERIMLSLVSTG DCP

FIVCMSYAFHTPDKLSFILDLMNG GGDLHYHLSQHGVFSEADMRFYAAEIILGLEHMHNRFVVYRDLK PANILLDEHGHVRISDLGLACDFSKKRPHA

SV VGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRG GHSPFRQHKTKDKHEIDRMTLTM AVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRG 

GAQEVKESPFFRSLDWQMVFLQK YPPPLIPPRGEVNAADAFDIGSFDEEDTKGIK LLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK

KAKNKQLGHEED DYALGKDCIVHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAP QSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCD S

DPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLIQRGSANGL
Transcript ENSMUST00000088737
Sequence
AGTCCCGGCGGGAGCGGAGCGCGAGCCGGGCCGGGCCCGAGCCGGCGCCATGGGGCGGCGCCGCCTGTGAGCCGGCGACGAGCGAGGACCGGGCGGGGCG

GCGGCGGCGCCGAGGCCCACAAGCCGCGCGGGCCGGGCCGGGCCGAGCGAGCGGGAGCGGAGCGGAGCCTCGGGCGGCGGGAGGAACAGCGCCGCCGCCG

CCGCCAAGATGGCCGACCTGGAGGCGGTGCTGGCCGATGTGAGCTACCTGATGGCCATGGAGAAGAGCAAGGCCACGCCGGCCGCGCGCGCCAGCAAGAA

GATCCTGCTGCCAGAGCCCAG - UNI19447 - - UNI36505 - CATCCGCAGCGTCATGCAGAAGTATCTGGAGGACCGAGGAGAAGTGACCTTT

GAAAAGATCTTTTCGCAGAAGTTAG - UNI13770 - - UNI19447 - - UNI36505 - GGTACCTGCTTTTCCGGGACTTCTGCCTGAACCAT

CTGGAAGAGGCCAAGCCCTTGGTGGAGTTCTACGAAGAG - UNI24663 - ATCAAGAAATATGAGAAGCTGGAGACAGAGGAGGAACGTGTGGTCCG

CAGCCGAGAGATCTTTGACTCCTATATTATGAAAGAACTGCTGGCCTGCTCACAT CCCTTTTCAAAGAATGCTACGGAGCATGTCCAGGGCCACCTGGT

GAAGAAGCAGGTGCCTCCAGATCTCTTCCAG CCATACATTGAGGAGATTTGTCAGAACCTCCGAGGGGACGTGTTCCAGAAGTTCATAGAGAG TGACA

AGTTCACACGGTTCTGCCAGTGGAAGAATGTTGAGCTCAACATCCAC CTGACCATGAATGACTTCAGTGTGCATCGAATCATCGGGCGTGGGGGCTTCG

GTGAGGTCTATGGGTGCCGGAAAGCAGACACAGGCAAGAT GTACGCCATGAAGTGTCTGGACAAGAAACGCATCAAGATGAAGCAGGGAGAGACCCTGG

CTCTGAACGAGCGGATCATGCTTTCCCTCGTCAGCACCGGG GACTGCCCCTTCATCGTGTGCATGTCATATGCATTCCACACACCAGACAAGCTCAGCT

TCATCCTGGACCTCATGAACG GTGGGGACCTGCACTACCACCTGTCTCAGCATGGAGTCTTCTCTGAAGCCGACATGCGCTTCTACGCCGCTGAGATCA

TCCTGGGCCTTGAACACATGCACAATCGCTTTGTAGTCTACAGGGACCTGAAG CCAGCCAACATTCTCCTGGATGAACATGGCCATGTGAGAATCTCGG

ACCTGGGCCTAGCCTGTGACTTCTCCAAGAAGAGGCCTCATGCCAGTGT GGGCACACACGGGTACATGGCCCCCGAAGTCCTACAGAAGGGCGTGGCCT

ATGACAGCAGTGCAGACTGGTTCTCCCTGGGCTGCATGCTCTTCAAGTTGTTGCGGGG ACACAGCCCCTTCCGGCAGCACAAGACCAAAGACAAGCATG

AGATTGACCGCATGACGTTGACGATG GCTGTAGAGCTGCCTGACTCCTTCTCCCCTGAACTCCGATCCCTGCTGGAAGGTTTGTTGCAGAGGGACGTCA

ATCGGAGACTAGGCTGTCTGGGCCGTGG GGCTCAGGAGGTAAAAGAAAGTCCTTTCTTTCGTTCCCTGGACTGGCAGATGGTCTTCTTACAGAAG TAC

CCTCCTCCACTGATCCCCCCACGTGGGGAGGTGAATGCAGCTGACGCTTTCGACATTGGCTCCTTTGATGAGGAGGACACAAAAGGAATCAAG TTACTG

GACAGTGACCAGGAACTGTACCGCAACTTCCCTCTCACCATCTCTGAGCGGTGGCAACAGGAGGTGGCAGAGACTGTCTTTGATACCATCAATGCTGAAA

CAGACCGGCTGGAGGCACGAAAGAAGGCCAAAAACAAACAGCTGGGCCACGAGGAGG ACTATGCCCTGGGTAAGGACTGCATCGTGCATGGCTACATGT

CCAAGATGGGCAACCCCTTCCTGACCCAGTGGCAGCGGCGATACTTCTACTTGTTCCCCAACCGGCTCGAGTGGAGGGGTGAAGGCGAGGCTCCG CAGA

GCCTCCTGACCATGGAGGAGATCCAGTCAGTGGAAGAGACACAGATCAAGGAACGCAAGTGTCTCCTGCTTAAGATCCGAGGTGGCAAGCAGTTTGTCCT

GCAGTGTGAT AGTGATCCAGAGCTGGTGCAATGGAAAAAGGAGCTGCGTGATGCCTACCGCGAGGCCCAGCAGCTGGTACAGCGAGTACCCAAGATGAA

GAACAAGCCACGCTCGCCTGTGGTGGAGCTGAGCAAGGTGCCGCTGATCCAGCGTGGCAGTGCCAACGGCCTCTGATCCACCCATGTGCTGCCCGCCTGC

CCACCCGCCTTTTATAAACCTCTAATTTATTTTGTTGAATTTTTATTATTTGTTTTCCCGCAAAGCGGAAAATGTTTTATTTTGTAATTATTGTGATCTC

CTGTGGCCCCAGCCTGGCCCAGCCCCCAGGGAGGGGCCCGCTTGCCTCAGCTCCTGCTGCCACCAACCCAGCCACTGTCTAGCACCCCTCCCCTGTCCCC

ACTCCCACCCCCTAGGGTCCTTGCTCCCAGTATCTTCCTACAGGGAAGAAGAGCAACCCTCAGCAGCCCTCTTGCCCCTCCATGGGGTGAAGCCACACTC

AGTGGGTGTGTCACTTCAGGCTCTGTGGGCTGTGCTCAGTCTGTGGCCCAGCACCCCTGCCCTAGAAAGGGGCAACACAGGGTACTACTTGAACTTTCCT

ATCACAGCTCCCATGCCACAGAGGGACAGACCCCTGCTGTCCTGCCCTCTTGCCACTGGTGAGAGAAGGCCCTTGTCTCCTCAGACTAGGAGGTCTCCCA

CAGTGACAGCTCCTGGGTCCTTGTTCAGGAAAAGCCTGTGTGTTACCACTGCCTCATCAGGAGGCTGCCATTGGCAGTGGCTGCTGCTGGCCTCCCTGCA

AGTCCCCTCTTCTTCCTGTTGCGTGCCTGGACTCAGGAGCATAGAAAAGACAATTGTGGATTGGGCCACACTGGCCTAGCCTGAACCTAGATCCCTAACC

CTGGGCTGGGTGAGGCTCACCTGCCCAGGACCACAGTGGGACAGCCTGGGCAGGTGGGTGGCACAGCATAAGAACCCAGCTGGGGCCAGCCCTCCCTGTC

CTGGCTGGTCAGTGTGCCCCCACCCACACTGTCCAGCCCCTTAGCCCATGTCATGTCAGTGGCCACTGCCCACAGGTGCCACCTTGCCCACCGCATGACC

CCTTGTGCCAGTCGCGCAGCTGTGTGTGGTGTCGCGCCCTCTCCCCTTGGGGGCTGGGTGGGCACACCCTCCCCTCTTGTCTACTCACTCCTAGGGCGTT

TCTTTGCCGATTTTTGAATGTGATTTTAAAGAGTGGAAAATGAGACTATGCGTTTTTATAAAAAATGGTGCCTG
Translation
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPS - UNI19447 - - UNI36505 - SIRSVMQKYLEDRGEVTFEKIFSQKLG - UNI13

770 - - UNI19447 - - UNI36505 - GYLLFRDFCLNHLEEAKPLVEFYEE - UNI24663 - IKKYEKLETEEERVVRSREIFDSYIMKEL

LACSH PFSKNATEHVQGHLVKKQVPPDLFQ PYIEEICQNLRGDVFQKFIES SDKFTRFCQWKNVELNIH LTMNDFSVHRIIGRGGFGEVYGCRKAD

TGKM MYAMKCLDKKRIKMKQGETLALNERIMLSLVSTG DCPFIVCMSYAFHTPDKLSFILDLMNG GGDLHYHLSQHGVFSEADMRFYAAEIILGLEH

MHNRFVVYRDLK PANILLDEHGHVRISDLGLACDFSKKRPHASV VGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRG GHSPFRQHKTKDKHEI

DRMTLTM AVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRG GAQEVKESPFFRSLDWQMVFLQK YPPPLIPPRGEVNAADAFDIGSFDEEDTKGIK 

LLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEED DYALGKDCIVHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGE

AP QSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCD SDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLIQRGSANGL

For any suggestions or comments, please send an email to unitrap@crg.es