Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024891 (Slc29a2)
Chromosomal location
Chr 19: 5024071 - 5031963 (+)
Description
solute carrier family 29 (nucleoside transporters), member 2 Gene [Source:MGI Symbol;Acc:MGI:1345278]
RefSeq_peptide
NP_031880.2 
UniGene
Mm.4930 
MGI
MGI:1345278 
Uniprot/SWISSPROT
Q61672 
Uniprot/SPTREMBL
Q9JIT8 
Human Ortholog
ENSG00000174669 (SLC29A2)
Omim not available
UniTrap UNI36058
Vector Insertion
Chr 19: 5024278 - 5024510
Public Clones IST13077C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32413
Vector Insertion
Chr 19: 5024593 - 5026027
Public Clones IST11884B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34739
Vector Insertion
Chr 19: 5027765 - 5028840
Public Clones IST13968F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025826
Sequence
GGTCCGAGCCTGCAAAACGTGGTCCGCAGTGTAACCCAACCCCGACCCTCCGCTACGGCGCTCCGACCTTGGGATTCCTGGACACCGACCAGCGTCGCTC

TCCTTCGGCCTCCCAGCCCTGCGTAGGCGCAGGTGCAGCCGCCTTCTGTGGGCCTGGTGCAATAGGACTGCGGCAACCATGGCGCGGGGAAACGCCCCTC

GGGACAG - UNI36058 - CTACCACCTGGTTGGGATCAGCTTCTTCATTCTGGGACTGGGCACCCTTCTCCCCTGGAACTTCTTCATTACCGCCATC

CCG - UNI32413 - TACTTCCAGGGGCGGTTAGCAGGGACCAACAGCAGTGCTGAGACCATGGGCACCAACCACACCAGTCCCACAGACACTTTCAA

CTTCAACAACTGGGTGACACTGCTGTCCCAGCTGCCTCTACTGCTCTTCACGCTCCTCAACTCCTTCCTGTATCAGTG CATCCCCGAGTCGGTGCGGAT

TCTGGGCAGCCTGCTGGCCATACTACTGCTCTTTGCCCTGACAGCAGCGTTGGTGAAGGTGGACTTGAGCCCTGGGCTGTTCTTCTCTGTCACCATGGCG

TCCGTCTGGTTCATCAATT CCTTCTGTGCCGTGCTTCAAGGCAGCCTCTTTGGGCAGCTGGGTACCATGCCTTCTACCTACAGCACCCTCTTCCTCAGT

GGCCAGGGCCTGGCTGGGATCTTCGCTGCCCTTGCTATGCTCATGTCCTTGGCCA GTGGCGTGGATGCCCAGACCTCTGCTCTTGGATACTTCATCACA

CCCTGTGTGGGCATCCTCCTCTCCATCGTATGTTACCTCAGCCTGCCTCATCTG AAGTTTGCCCGTTACTACCTGACCGAGAAGCTGTCTCAGGCTCCA

ACTCAGGAGCTGGAGACTAAAGCTGAGCTCCTCCAAGCTG - UNI34739 - ATGAGAAGAATGGGGTTCCCATCAGCCCCCAACAGGCCAGCCCAAC

TCTGGATCTTGACCCTGAGAAGGAGCCAGAGCCGGAGGAGCCACAGAAGCCAGGAAAACCTTCAGTCTTTGTTGTCTTCCGGAAG ATCTGGCTGACGGC

GCTGTGCCTTGTGTTGGTCTTCACAGTCACCCTGTCGGTCTTTCCTGCCATCACAGCCATGGTGACCACCAGCTCCAATAGCCCCGGGAAGTGGG GTCT

GTTCTTCAACCCTATCTGTTGCTTTCTGCTCTTCAACGTCATGGATTGGCTGGGCCGGAGCCTGACCTCCTACTTCCTGTGG CCAGATGAGGACAGTCA

GCAGCTGCTGCCCCTGCTGGTGTGCCTGCGCTTCCTGTTTGTCCCACTCTTCATGCTGTGCCACGTGCCCCAGCACGCCCGGCTGCCCATCATCTTCAGG

CAGGATGCCTACTTCATCACCTTCATGCTGCTCTTCGCTGTTTCCAACGGCTACTTGGTGTCTCTCACCATGTGCCTGGCACCCAG GCAGGTGTTGCCA

CATGAGAGGGAGGTAGCCGGAGCCCTCATGACCTTCTTCCTGGCCCTGGGACTCTCCTGCGGAGCCTCCCTCTCCTTCCTCTTCAAGGCTTTACTCTGAG

GACCACCAGTGCTCCACACAGTCCTCCCCTCAGTGCAGCTTCTGGAGTTGGGACGTTCACAGGGAAGGACCTCCAATATACCTGGTCTCTTGGTCTGTGG

GTTCGTGGCTGGTAGCCACGTTGCATATGGTGAGGAAGAATCCACCACTGGTCACTCTGCCTCTCAGCTAGGAGTAACACGGGACACAGAAACCTGGAGC

TCACAGAGATGCACAAAAGGGCAAGTTGGAAGGCAGCTATGGGGGAAGCAGGCGCAGGGCCCTTCACTGCCCTCCTGACTACATTTCTTCATCAGTCCAT

CCACTGACCCCAGGGAGCAAAGCCAGCTGTAGGTCTTGCTTAGGACACCCTGACGGTCTCTACCTCGGCTCAGAGTGGGACCTGGGACCAGCTCCAGAGC

GTCAGCGTCCCCTTCTCACCCACAGGCCCTGACAGGGCATGAAGTGTCATGGAAACTGAGGGGAAGAGAAAGCTCAAAGGACCTCTGAGCCTCCAACAGG

GTTTTCTCGAAGCCAACACCCCTAGAATCCAGATGGGCCTGTCTGACAGAAAGGCAGTTGGCCTGCATGTGTTGTGCACTGCACTTTACAGTTTGCAAAG

TTTTTCCAGAAGCCTCTGTGAGGCCTTTGGAACAAGCTGGGCAGGGATCATCCCCAGGTGGGATTCGACTGTCTATGGAAGAGTAAGGCGATGGCCTTCA

TCGCCTTCCTTGTAGGTGCTGCCCCTGTCCCGCCACTTGCTTCTTTTCCTCAAAGTTCTCCAGGCAGGTGCCCTCGGCACTTGCTACTGTGTTTTTGCCC

CATTTCTCCTCCGACCCTGCTCCTGCATCCAATTAAAACTGTTCATTTC
Translation
MARGNAPRDS - UNI36058 - SYHLVGISFFILGLGTLLPWNFFITAIP - UNI32413 - YFQGRLAGTNSSAETMGTNHTSPTDTFNFNNWVT

LLSQLPLLLFTLLNSFLYQC CIPESVRILGSLLAILLLFALTAALVKVDLSPGLFFSVTMASVWFINS SFCAVLQGSLFGQLGTMPSTYSTLFLSGQG

LAGIFAALAMLMSLAS SGVDAQTSALGYFITPCVGILLSIVCYLSLPHL KFARYYLTEKLSQAPTQELETKAELLQAD - UNI34739 - DEKNGV

PISPQQASPTLDLDPEKEPEPEEPQKPGKPSVFVVFRK IWLTALCLVLVFTVTLSVFPAITAMVTTSSNSPGKWG GLFFNPICCFLLFNVMDWLGRSL

TSYFLW PDEDSQQLLPLLVCLRFLFVPLFMLCHVPQHARLPIIFRQDAYFITFMLLFAVSNGYLVSLTMCLAPR RQVLPHEREVAGALMTFFLALGLS

CGASLSFLFKALL

For any suggestions or comments, please send an email to unitrap@crg.es