Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024900 (Cpt1a)
Chromosomal location
Chr 19: 3323348 - 3384119 (+)
Description
carnitine palmitoyltransferase 1a, liver Gene [Source:MGI Symbol;Acc:MGI:1098296]
RefSeq_dna
NM_013495 
RefSeq_peptide
NP_038523.2 
UniGene
Mm.18522 
MGI
MGI:1098296 
Uniprot/SWISSPROT
P97742 
Uniprot/SPTREMBL
A8ASF5 Q3UGT1 Q7TQD5 
Human Ortholog
ENSG00000110090 (CPT1A)
Omim 255120 - CARNITINE PALMITOYLTRANSFERASE I DEFICIENCY  
UniTrap UNI20609
Vector Insertion
Chr 19: 3323375 - 3349188
Public Clones (ggtc) P119F02 (ggtc) IST10787E1 (tigm) IST14452F6 (tigm) IST11385G8 (tigm)
IST12572E7 (tigm) IST10267G10 (tigm) IST12308B12 (tigm)
Private Clones OST357087 (lexicon) OST193056 (lexicon) OST66471 (lexicon) OST39623 (lexicon)
OST31042 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27706
Vector Insertion
Chr 19: 3349343 - 3352484
Public Clones IST14310D7 (tigm) IST11511H12 (tigm)
Private Clones OST52454 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34549
Vector Insertion
Chr 19: 3352625 - 3356316
Public Clones IST10626E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30889
Vector Insertion
Chr 19: 3358278 - 3362084
Public Clones IST13879H11 (tigm) IST13651A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32548
Vector Insertion
Chr 19: 3364556 - 3365674
Public Clones IST11626H12 (tigm) IST11354E7 (tigm) IST14508H10 (tigm) IST13486D10 (tigm)
IST12283C5 (tigm) IST10876D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025835
Sequence
ATTCCGCCGCCGCCGTCTGCAGACTCG - UNI20609 - GTCACCACTCAAGATGGCAGAGGCTCACCAAGCTGTGGCCTTCCAGTTCACAGTCACCC

CTGATGGCATCGATCTCCGCCTGAGCCATGAAGCCCTCAAACAGATCTGCCTGTCAGGGCTGCACTCCTGGAAGAAGAAGTTCATCCGATTCAAG - UN

I27706 - AATGGCATCATCACTGGTGTGTTCCCCGCGAGTCCCTCCAGCTGGCTTATCGTGGTGGTGGGTGTGATATCATCCATGCATACCAAAGTGG

ACCCCTCCCTGGGCATGATTGCAAAGATCAATCGGACCCTAGACACCAC - UNI34549 - TGGCCGCATGTCAAGCCAGACGAAGAACATCGTGAGT

GGCGTCCTCTTTGGCACAGGGCTCTGGGTGGCGATCATCATGACTATGCGCTACTCGCTGAAGGTGCTGCTCTCCTACCATGGCTGGATGTTTGCAGAGC

ACGGCAAAATGAGCCGCAGCACCAGAATCTGGATG GCTATGGTCAAGGTCTTCTCGGGTCGAAAGCCCATGTTGTACAGCTTCCAGACGTCTCTGCCGC

GCCTGCCTGTCCCAGCTGTCAAAGATACCGTGAGCAGG - UNI30889 - TACCTGGAGTCTGTGAGGCCACTGATGAAGGAGGGAGACTTCCAACGC

ATGACAGCACTGGCCCAGGATTTTGCTGTCAACCTTGGACCCAAATTGCAGTGGTATTTGAAGCTAAAATCCTGGTGGGCCACAAATTAT GTGAGTGAC

TGGTGGGAGGAATACATCTACCTGCGGGGCCGAGGGCCGATCATGGTTAACAGCAACTACTACGCCATG - UNI32547 - GAGATGCTCTACATCAC

CCCAACCCATATTCAGGCAGCGAGAGCTGGCAACACCATCCACGCCATACTGCTGTATCGTCGCACGGTAGACCGTGAGGAACTCAAACCT ATTCGTCT

TCTGGGATCTACAATTCCCCTCTGCTCTGCTCAGTGGGAGCGACTCTTCAATACTTCCCGCATCCCTGGGGAGGAGACAG ACACCATCCAACACGTCAA

GGACAGCAGGCACATTGTCGTGTACCACAGAGGCCGTTACTTCAAGGTCTGGCTCTACCATGACGGGAGGCTGCTGAGGCCCCGTGAGCTGGAGCAGCAG

ATGCAGCAGATCCTGGATGACACCTCAGAGCCGCAGCCCGGGGAAGCCAAGCTTGCCGCCCTCACTGCCGCAGACAG AGTGCCCTGGGCGAAGTGTCGG

CAGACCTATTTTGCACGAGGAAAAAATAAGCAATCTCTGGATGCGGTAGAAAAGGCAGCATTCTTCGTGACGTTGGACGAATCGGAACAGGGATATAGAG

AGGAGGACCCTGAGGCATCTATTGACAGCTATGCCAAATCTCTGCTGCATGGTAGATGTTTCGACAG GTGGTTTGACAAGTCCATCACCTTTGTTGTCT

TCAAAAACAGCAAGATAGGCATAAACGCAGAGCATTCCTGGGCGGACGCGCCCATCGTGGGCCATCTGTGGGAG TATGTCATGGCCACCGACGTCTTCC

AGCTGGGCTACTCAGAGGATGGACACTGTAAAGGAGACAAGAACCCCAACATCCCCAAACCCACCAGGCTACAGTGGGACATTCCAGGAGAA TGCCAGG

AGGTCATAGAGACATCCCTAAGCAGTGCCAGTTTTTTGGCAAATGATGTGGACCTGCATTCCTTCCCATTTGACACCTTTGGCAAAGGCTTGATCAAGAA

GTGCCGGACGAGTCCCGATGCCTTCATCCAGCTGGCACTGCAGCTCGCACATTACAAG GACATGGGCAAGTTCTGCCTCACGTATGAGGCTTCCATGAC

TCGGCTCTTCCGAGAGGGGAGGACAGAGACTGTACGCTCCTGCACTACGGAGTCCTGCAACTTTGTGCTGGCCATGATGGACCCCACAACAACG GCAGA

GCAGAGGTTCAAGCTGTTCAAGATAGCTTGTGAAAAGCACCAGCACCTGTACCGCCTCGCCATGACGGGCGCTGGCATCGACCGCCACCTCTTCTGCCTC

TATGTGGTGTCCAAGTATCTGGCAGTCGACTCACCTTTCCTGAAGGAG GTACTGTCTGAGCCATGGAGGTTGTCCACGAGCCAGACTCCTCAGCAGCAG

GTGGAACTGTTTGACTTTGAGAAATACCCTGACTATGTGTCCTGTGGCGGGGGCTTTGGGCCG GTTGCTGATGACGGCTATGGTGTTTCCTACATTATT

GTGGGAGAGAATTTCATCCACTTCCATATTTCTTCCAAGTTCTCTAGCCCTGAGACA GACTCACACCGCTTTGGGAAGCACTTGAGACAAGCCATGATG

GACATTATCACCTTGTTTGGCCTCACCGCCAATTCCAAAAAGTAACTGTCGGAGCCGCACGGAAGGAAAATGGACTCTAGTGATACAAACCAAATGAATA

GGTGTTGCTCCTGACCATAGGACAGGCAGAAAATTGTTCTTATAAAACTCAGTTTTCCTTCCAGAAGGTTTACCGTCGGTCTCCCTAGAACAACCGTAGG

CTCCACCGTTTGACTTGTGACCCTACTACATCCAGAGATGCCTTGGCTCCAGGAATATTGGGCACAGTCCCCCGAAGTCTTTTGAATCGGCTCCTAATGG

ATAAAGGGATTTAAATGCTGGTG
Translation
 - UNI20609 - MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFK - UNI27706 - NGIITGVFPASPSSWLIVVVGVISS

MHTKVDPSLGMIAKINRTLDTT - UNI34549 - TGRMSSQTKNIVSGVLFGTGLWVAIIMTMRYSLKVLLSYHGWMFAEHGKMSRSTRIWM AMVKV

FSGRKPMLYSFQTSLPRLPVPAVKDTVSR - UNI30889 - YLESVRPLMKEGDFQRMTALAQDFAVNLGPKLQWYLKLKSWWATNY VSDWWEEYIY

LRGRGPIMVNSNYYAM - UNI32547 - EMLYITPTHIQAARAGNTIHAILLYRRTVDREELKP IRLLGSTIPLCSAQWERLFNTSRIPGEETD DT

IQHVKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELEQQMQQILDDTSEPQPGEAKLAALTAADR RVPWAKCRQTYFARGKNKQSLDAVEKAAFFVTLDE

SEQGYREEDPEASIDSYAKSLLHGRCFDR RWFDKSITFVVFKNSKIGINAEHSWADAPIVGHLWE YVMATDVFQLGYSEDGHCKGDKNPNIPKPTRLQ

WDIPGE CQEVIETSLSSASFLANDVDLHSFPFDTFGKGLIKKCRTSPDAFIQLALQLAHYK DMGKFCLTYEASMTRLFREGRTETVRSCTTESCNFVL

AMMDPTTT AEQRFKLFKIACEKHQHLYRLAMTGAGIDRHLFCLYVVSKYLAVDSPFLKE VLSEPWRLSTSQTPQQQVELFDFEKYPDYVSCGGGFGP 

VADDGYGVSYIIVGENFIHFHISSKFSSPET DSHRFGKHLRQAMMDIITLFGLTANSKK

For any suggestions or comments, please send an email to unitrap@crg.es