Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024968 (Rcor2)
Chromosomal location
Chr 19: 7341894 - 7349714 (+)
Description
REST corepressor 2 Gene [Source:MGI (curated);Acc:Rcor2-001]
RefSeq_dna
NM_054048 
RefSeq_peptide
NP_473389.1 
UniGene
Mm.283859 
MGI
MGI:1859854 
Uniprot/SWISSPROT
Q8C796 
Human Ortholog
ENSG00000167771 (RCOR2)
Omim not available
UniTrap UNI19263
Vector Insertion
Chr 19: 7341915 - 7343340
Public Clones IST11551E6 (tigm) IST13870G4 (tigm) IST13879G5 (tigm) IST12009E7 (tigm)
IST15058F11 (tigm) IST13901D6 (tigm) IST10963F7 (tigm)
Private Clones OST398205 (lexicon) OST253199 (lexicon) OST231494 (lexicon) OST159203 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15482
Vector Insertion
Chr 19: 7343579 - 7344254
Public Clones (sanger) PST7401-NR (escells) PST9534-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20863
Vector Insertion
Chr 19: 7344254 - 7344312
Public Clones not available
Private Clones OST349428 (lexicon) OST214728 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14924
Vector Insertion
Chr 19: 7344312 - 7344590
Public Clones PST11132-NR (escells) PST1746-NR (escells) PST1233-NR (escells) PST8420-NR (escells)
PST1348-NR (escells) PST13844-NR (escells) PST4363-NR (escells) IST14447E9 (tigm)
Private Clones OST258044 (lexicon) OST220488 (lexicon) OST182090 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15211
Vector Insertion
Chr 19: 7344672 - 7345043
Public Clones PST9843-NR (escells) IST14768F8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19299
Vector Insertion
Chr 19: 7346045 - 7347589
Public Clones not available
Private Clones OST395753 (lexicon)
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29190
Vector Insertion
Chr 19: 7347668 - 7348322
Public Clones not available
Private Clones OST6290 (lexicon)
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113369
Sequence
ACAGGCTTCGAGCTGCTGCCG - UNI19263 - CCTCAGTGGCGACCCCTCCAGGCCGGGCCAGGCGCAGCACTCGAGGCAAGCGCGGCAAGCTCCTG

CGCTCTCCAAAGGATCCCGTGCCCCTCGGGGCTGCCGGGTAGGGTAATGCCCTCAGTAATGGAGAAGCCCAGTGCGGGCTCCGGGATCTTGTCCCGAAGT

CGGGCCAAGACGGCACCCAACGGCGGACAGCCACACTCGGAGGATGACAGCAGCGAGGAGGAGCACTCTCATG - UNI15482 - - UNI20863 - 

ACAGCATGATCCGAGTTGGAACCAATTACCAAGCAGTAATTCCGGAGTGCAAGCCTG - UNI14924 - - UNI20863 - AGAGCCCTGCACGCTA

TAGCAACAAGGAGCTGAAGGGAATGCTGGTGTGGTCCCCCAACCACTGTGTATCAGATGCCAAAC - UNI15211 - TTGACAAGTACATTGCAATGG

CCAAGGAGAAGCATGGCTATAACATTGAGCAG GCACTCGGCATGCTTCTGTGGCATAAACACGATGTGGAGAAATCACTGGCTGACCTAGCCAACTTCA

CTCCCTTCCCTGATGAGTGGACGGTGGAGGACAAGGTGCTGTTTGAACAGGCCTTTGGGTTCCATGGCAAGTGCTTCCAGCGGATCCAGCAGATG CTCC

CTGACAAGGTGATTCCCAGCCTGGTGAAGTATTACTACTCTTGGAAGAAGACCCGAAGTCGAACTAGTGTGATGGACAGGCAGGCCAGGCGGCTGGGTGG

CCGCAAGGACAAAGAAGACAG TGATGAACTAGAAGAGGGACGAGGAGCTGTGAGTGAGGGGGAACCGGATACTGGAGACCCCAAGCGAGAG CCTCTGC

CATCCAGACCTCTGAATGCACGGCCTGGTCCTGGGAAGAAGGAGGTTCAGATATCTCAGTATCGCCACCACCCACTTCGAACTCGGAGACGTCCGCCCAA

GGGCATGTACCTGAGTCCTGAAGGCCTCACTGCAGTATCGGGAAGCCCAGACCTCGCTAACCTCACACTCCGAGGTCTTGACTCACAGCTCATCTCTCTT

AAGCGCCAG - UNI19299 - GTCCAGAGCATGAAGCAGACCAATAGCAGCCTCCGCCAAGCACTGGAGGGCGGCATTGACCCTCTCCGCCCCCCTGA

G - UNI29190 - GCTAATACCAAGTTCAACTCCCGCTGGACCACTGATGAGCAACTTCTAGCTGTTCAAG CTATTCGTAGATACGGCAAAGACTTT

GGGGCTATTGCAGAGGTGATTGGGAACAAGACTCTGACCCAAGTGAAGACCTTCTTTGTGAGCTATCGTCGCCGCTTCAACCTGGAAGAGGTGCTGCAGG

AATGGGAGGCTGAGCAGGATGGGGCCCCCGCAGCTCCGGTCCCCACGGAAGAGGCCAGGCGAGGGGCTCCTGTACCAGCCACAGCCCTAGAAGAAGATGA

TGAG GTCCAGATTACATCTGTCTCAACATCAGTACCCCGATCAGTACCCCCTGCACCGCCCCCACCTCCACCGCCCACCTCGCTTTCCCAGCCACCCCC

GCTGCTGAGGCCACCTCTGCCCACAGCTCCCACATTGCTCCGCCAGCCGCCTCCCCTGCAGCAGGGCCGCTTCCTGCAGCCTCGGCTGGCCCCCAACCAG

CCTCCACCACCGCTCATCCGCCCTGCCCTGGCTGCCTCTCGCCACAGTGCCCGCCCTGGTCCTCAGCCTCCACCTACCCTGGTTGGAGCTCCTTTGGAGC

CCCCTGCACCCTCACTTTGAGCCTGAATCCTCCATTGCCCAGAGGCTCCTGAACCCCTTTGGCTGGATCTCTCTGGCAGCACTAAGGACAGAAGGGACTA

GGGCTCTTGCCAGGTCTTTCAAATACCCAAAGCTGCCAGTTGGCACAGCTTGGACCTGTGGGTTCTGCATGTGTTCCTGGCAGCTGAGCTTGTAAACCCC

CAGCCAGGGGCTAGATCTCAGGGCCTGCAGGGACTCTTGCTTCCTGGCTGTGACTGGAATGGCTGCCTCCTTGCCTGCCTGCCTGCAGAGGGCTTGGCCT

CTGGGCCTACCCTTTGTGTGGGGGTAATGACTTTAGCCTGGGGGATGGGGGAGAGGACAGGATGTTAGCTGGCCTCATTCACCTTTCCTTCTTTTTAGCA

ATAAGTCAGGTGCAGTGGAAGGGGATTGGGGTGGGGATGGCAGAAATCTGGTGGGAAGAATGTTGGGTAGCTGTGAGGAGACCCACTTTGTCCACCCCCA

AAAGTTTGGAGAAAGAAGGGTTGGGGACTTACACAGACATGGGTTTATTTTTCAACATTTTTAAAAAATAAATGCAACCTTGAATGT
Translation
 - UNI19263 -  - UNI15482 - - UNI20863 - MIRVGTNYQAVIPECKPE - UNI14924 - - UNI20863 - ESPARYSNKELKGM

LVWSPNHCVSDAKL - UNI15211 - LDKYIAMAKEKHGYNIEQ ALGMLLWHKHDVEKSLADLANFTPFPDEWTVEDKVLFEQAFGFHGKCFQRIQQ

M LPDKVIPSLVKYYYSWKKTRSRTSVMDRQARRLGGRKDKEDS SDELEEGRGAVSEGEPDTGDPKRE PLPSRPLNARPGPGKKEVQISQYRHHPLRT

RRRPPKGMYLSPEGLTAVSGSPDLANLTLRGLDSQLISLKRQ - UNI19299 - VQSMKQTNSSLRQALEGGIDPLRPPE - UNI29190 - ANTK

FNSRWTTDEQLLAVQA AIRRYGKDFGAIAEVIGNKTLTQVKTFFVSYRRRFNLEEVLQEWEAEQDGAPAAPVPTEEARRGAPVPATALEEDDE VQITS

VSTSVPRSVPPAPPPPPPPTSLSQPPPLLRPPLPTAPTLLRQPPPLQQGRFLQPRLAPNQPPPPLIRPALAASRHSARPGPQPPPTLVGAPLEPPAPSL
Transcript ENSMUST00000066646
Sequence
CCTCAGCGCAGCCGAGGGGCGCGGAGTCAGCTGCGGCGGCCACTGCGCGGTAGCCCTTGCTGGCCAAACAGCGTGGGCAGGCGCGCGGCGCGGCTCCGGG

GCTCCCCGAGGGCAACGCGCCCCGACTCTCCCCGGGGGAGAACCAGCCCCGAGGGGCGCACGGAGCGAGCGTGCCCCCGGCCGCGCCGTCTCCCCCGTAC

CCCCACTTCACAAACTTTTCTGCCGTCCTCGCCCGTGGGGGTCGCAGTGAGCGTTAGGGCTGCCCTCCGGGGCCCCGACCTCCCGGACCCTAGCCACGCT

GACCTCCTGCCTCTCGTAGCCTCAGTGGCGACCCCTCCAGGCCGGGCCAGGCGCAGCACTCGAGGCAAGCGCGGCAAGCTCCTGCGCTCTCCAAAGGATC

CCGTGCCCCTCGGGGCTGCCGGGTAGGGTAATGCCCTCAGTAATGGAGAAGCCCAGTGCGGGCTCCGGGATCTTGTCCCGAAGTCGGGCCAAGACGGCAC

CCAACGGCGGACAGCCACACTCGGAGGATGACAGCAGCGAGGAGGAGCACTCTCATG - UNI15482 - - UNI20863 - ACAGCATGATCCGAGT

TGGAACCAATTACCAAGCAGTAATTCCGGAGTGCAAGCCTG - UNI14924 - - UNI20863 - AGAGCCCTGCACGCTATAGCAACAAGGAGCTG

AAGGGAATGCTGGTGTGGTCCCCCAACCACTGTGTATCAGATGCCAAAC - UNI15211 - TTGACAAGTACATTGCAATGGCCAAGGAGAAGCATGG

CTATAACATTGAGCAG GCACTCGGCATGCTTCTGTGGCATAAACACGATGTGGAGAAATCACTGGCTGACCTAGCCAACTTCACTCCCTTCCCTGATGA

GTGGACGGTGGAGGACAAGGTGCTGTTTGAACAGGCCTTTGGGTTCCATGGCAAGTGCTTCCAGCGGATCCAGCAGATG CTCCCTGACAAGGTGATTCC

CAGCCTGGTGAAGTATTACTACTCTTGGAAGAAGACCCGAAGTCGAACTAGTGTGATGGACAGGCAGGCCAGGCGGCTGGGTGGCCGCAAGGACAAAGAA

GACAG TGATGAACTAGAAGAGGGACGAGGAGCTGTGAGTGAGGGGGAACCGGATACTGGAGACCCCAAGCGAGAG CCTCTGCCATCCAGACCTCTGAA

TGCACGGCCTGGTCCTGGGAAGAAGGAGGTTCAGATATCTCAGTATCGCCACCACCCACTTCGAACTCGGAGACGTCCGCCCAAGGGCATGTACCTGAGT

CCTGAAGGCCTCACTGCAGTATCGGGAAGCCCAGACCTCGCTAACCTCACACTCCGAGGTCTTGACTCACAGCTCATCTCTCTTAAGCGCCAG - UNI1

9299 - GTCCAGAGCATGAAGCAGACCAATAGCAGCCTCCGCCAAGCACTGGAGGGCGGCATTGACCCTCTCCGCCCCCCTGAG - UNI29190 - G

CTAATACCAAGTTCAACTCCCGCTGGACCACTGATGAGCAACTTCTAGCTGTTCAAG CTATTCGTAGATACGGCAAAGACTTTGGGGCTATTGCAGAGG

TGATTGGGAACAAGACTCTGACCCAAGTGAAGACCTTCTTTGTGAGCTATCGTCGCCGCTTCAACCTGGAAGAGGTGCTGCAGGAATGGGAGGCTGAGCA

GGATGGGGCCCCCGCAGCTCCGGTCCCCACGGAAGAGGCCAGGCGAGGGGCTCCTGTACCAGCCACAGCCCTAGAAGAAGATGATGAG GTCCAGATTAC

ATCTGTCTCAACATCAGTACCCCGATCAGTACCCCCTGCACCGCCCCCACCTCCACCGCCCACCTCGCTTTCCCAGCCACCCCCGCTGCTGAGGCCACCT

CTGCCCACAGCTCCCACATTGCTCCGCCAGCCGCCTCCCCTGCAGCAGGGCCGCTTCCTGCAGCCTCGGCTGGCCCCCAACCAGCCTCCACCACCGCTCA

TCCGCCCTGCCCTGGCTGCCTCTCGCCACAGTGCCCGCCCTGGTCCTCAGCCTCCACCTACCCTGGTTGGAGCTCCTTTGGAGCCCCCTGCACCCTCACT

TTGAGCCTGAATCCTCCATTGCCCAGAGGCTCCTGAACCCCTTTGGCTGGATCTCTCTGGCAGCACTAAGGACAGAAGGGACTAGGGCTCTTGCCAGGTC

TTTCAAATACCCAAAGCTGCCAGTTGGCACAGCTTGGACCTGTGGGTTCTGCATGTGTTCCTGGCAGCTGAGCTTGTAAACCCCCAGCCAGGGGCTAGAT

CTCAGGGCCTGCAGGGACTCTTGCTTCCTGGCTGTGACTGGAATGGCTGCCTCCTTGCCTGCCTGCCTGCAGAGGGCTTGGCCTCTGGGCCTACCCTTTG

TGTGGGGGTAATGACTTTAGCCTGGGGGATGGGGGAGAGGACAGGATGTTAGCTGGCCTCATTCACCTTTCCTTCTTTTTAGCAATAAGTCAGGTGCAGT

GGAAGGGGATTGGGGTGGGGATGGCAGAAATCTGGTGGGAAGAATGTTGGGTAGCTGTGAGGAGACCCACTTTGTCCACCCCCAAAAGTTTGGAGAAAGA

AGGGTTGGGGACTTACACAGACATGGGTTTATTTTTCAACATTTTTAAAAAATAAATGCAACCTTGAATGT
Translation
MPSVMEKPSAGSGILSRSRAKTAPNGGQPHSEDDSSEEEHSHD - UNI15482 - - UNI20863 - DSMIRVGTNYQAVIPECKPE - UNI1492

4 - - UNI20863 - ESPARYSNKELKGMLVWSPNHCVSDAKL - UNI15211 - LDKYIAMAKEKHGYNIEQ ALGMLLWHKHDVEKSLADLANF

TPFPDEWTVEDKVLFEQAFGFHGKCFQRIQQM LPDKVIPSLVKYYYSWKKTRSRTSVMDRQARRLGGRKDKEDS SDELEEGRGAVSEGEPDTGDPKRE

 PLPSRPLNARPGPGKKEVQISQYRHHPLRTRRRPPKGMYLSPEGLTAVSGSPDLANLTLRGLDSQLISLKRQ - UNI19299 - VQSMKQTNSSLRQ

ALEGGIDPLRPPE - UNI29190 - ANTKFNSRWTTDEQLLAVQA AIRRYGKDFGAIAEVIGNKTLTQVKTFFVSYRRRFNLEEVLQEWEAEQDGAP

AAPVPTEEARRGAPVPATALEEDDE VQITSVSTSVPRSVPPAPPPPPPPTSLSQPPPLLRPPLPTAPTLLRQPPPLQQGRFLQPRLAPNQPPPPLIRPA

LAASRHSARPGPQPPPTLVGAPLEPPAPSL
Transcript ENSMUST00000025920
Sequence
ACAGGCTTCGAGCTGCTGCCG - UNI19263 - CCTCAGTGGCGACCCCTCCAGGCCGGGCCAGGCGCAGCACTCGAGGCAAGCGCGGCAAGCTCCTG

CGCTCTCCAAAGGATCCCGTGCCCCTCGGGGCTGCCGGGTAGGGTAATGCCCTCAGTAATGGAGAAGCCCAGTGCGGGCTCCGGGATCTTGTCCCGAAGT

CGGGCCAAGACGGCACCCAACGGCGGACAGCCACACTCGGAGGATGACAGCAGCGAGGAGGAGCACTCTCATG - UNI15482 - - UNI20863 - 

ACAGCATGATCCGAGTTGGAACCAATTACCAAGCAGTAATTCCGGAGTGCAAGCCTG - UNI14924 - - UNI20863 - AGAGCCCTGCACGCTA

TAGCAACAAGGAGCTGAAGGGAATGCTGGTGTGGTCCCCCAACCACTGTGTATCAGATGCCAAAC - UNI15211 - TTGACAAGTACATTGCAATGG

CCAAGGAGAAGCATGGCTATAACATTGAGCAG GCACTCGGCATGCTTCTGTGGCATAAACACGATGTGGAGAAATCACTGGCTGACCTAGCCAACTTCA

CTCCCTTCCCTGATGAGTGGACGGTGGAGGACAAGGTGCTGTTTGAACAGGCCTTTGGGTTCCATGGCAAGTGCTTCCAGCGGATCCAGCAGATG CTCC

CTGACAAGGTGATTCCCAGCCTGGTGAAGTATTACTACTCTTGGAAGAAGACCCGAAGTCGAACTAGTGTGATGGACAGGCAGGCCAGGCGGCTGGGTGG

CCGCAAGGACAAAGAAGACAG TGATGAACTAGAAGAGGGACGAGGAGCTGTGAGTGAGGGGGAACCGGATACTGGAGACCCCAAGCGAGAG CCTCTGC

CATCCAGACCTCTGAATGCACGGCCTGGTCCTGGGAAGAAGGAGGTTCAGATATCTCAGTATCGCCACCACCCACTTCGAACTCGGAGACGTCCGCCCAA

GGGCATGTACCTGAGTCCTGAAGGCCTCACTGCAGTATCGGGAAGCCCAGACCTCGCTAACCTCACACTCCGAGGTCTTGACTCACAGCTCATCTCTCTT

AAGCGCCAG - UNI19299 - GTCCAGAGCATGAAGCAGACCAATAGCAGCCTCCGCCAAGCACTGGAGGGCGGCATTGACCCTCTCCGCCCCCCTGA

G - UNI29190 - GCTAATACCAAGTTCAACTCCCGCTGGACCACTGATGAGCAACTTCTAGCTGTTCAAG CTATTCGTAGATACGGCAAAGACTTT

GGGGCTATTGCAGAGGTGATTGGGAACAAGACTCTGACCCAAGTGAAGACCTTCTTTGTGAGCTATCGTCGCCGCTTCAACCTGGAAGAGGTGCTGCAGG

AATGGGAGGCTGAGCAGGATGGGGCCCCCGCAGCTCCGGTCCCCACGGAAGAGGCCAGGCGAGGGGCTCCTGTACCAGCCACAGCCCTAGAAGAAGATGA

TGAG GTCCAGATTACATCTGTCTCAACATCAGTACCCCGATCAGTACCCCCTGCACCGCCCCCACCTCCACCGCCCACCTCGCTTTCCCAGCCACCCCC

GCTGCTGAGGCCACCTCTGCCCACAGCTCCCACATTGCTCCGCCAGCCGCCTCCCCTGCAGCAGGGCCGCTTCCTGCAGCCTCGGCTGGCCCCCAACCAG

CCTCCACCACCGCTCATCCGCCCTGCCCTGGCTGCCTCTCGCCACAGTGCCCGCCCTGGTCCTCAGCCTCCACCTACCCTGGTTGGAGCTCCTTTGGAGC

CCCCTGCACCCTCACTTTGAGCCTGAATCCTCCATTGCCCAGAGGCTCCTGAACCCCTTTGGCTGGATCTCTCTGGCAGCACTAAGGACAGAAGGGACTA

GGGCTCTTGCCAGGTCTTTCAAATACCCAAAGCTGCCAGTTGGCACAGCTTGGACCTGTGGGTTCTGCATGTGTTCCTGGCAGCTGAGCTTGTAAACCCC

CAGCCAGGGGCTAGATCTCAGGGCCTGCAGGGACTCTTGCTTCCTGGCTGTGACTGGAATGGCTGCCTCCTTGCCTGCCTGCCTGCAGAGGGCTTGGCCT

CTGGGCCTACCCTTTGTGTGGGGGTAATGACTTTAGCCTGGGGGATGGGGGAGAGGACAGGATGTTAGCTGGCCTCATTCACCTTTCCTTCTTTTTAGCA

ATAAGTCAGGTGCAGTGGAAGGGGATTGGGGTGGGGATGGCAGAAATCTGGTGGGAAGAATGTTGGGTAGCTGTGAGGAGACCCACTTTGTCCACCCCCA

AAAGTTTGGAGAAAGAAGGGTTGGGGACTTACACAGACATGGGTTTATTTTTCAACATTTTTAAAAAATAAATGCAACCTTGAATGT
Translation
 - UNI19263 - MPSVMEKPSAGSGILSRSRAKTAPNGGQPHSEDDSSEEEHSHD - UNI15482 - - UNI20863 - DSMIRVGTNYQAVIPE

CKPE - UNI14924 - - UNI20863 - ESPARYSNKELKGMLVWSPNHCVSDAKL - UNI15211 - LDKYIAMAKEKHGYNIEQ ALGMLLWH

KHDVEKSLADLANFTPFPDEWTVEDKVLFEQAFGFHGKCFQRIQQM LPDKVIPSLVKYYYSWKKTRSRTSVMDRQARRLGGRKDKEDS SDELEEGRGA

VSEGEPDTGDPKRE PLPSRPLNARPGPGKKEVQISQYRHHPLRTRRRPPKGMYLSPEGLTAVSGSPDLANLTLRGLDSQLISLKRQ - UNI19299 -

 VQSMKQTNSSLRQALEGGIDPLRPPE - UNI29190 - ANTKFNSRWTTDEQLLAVQA AIRRYGKDFGAIAEVIGNKTLTQVKTFFVSYRRRFNLE

EVLQEWEAEQDGAPAAPVPTEEARRGAPVPATALEEDDE VQITSVSTSVPRSVPPAPPPPPPPTSLSQPPPLLRPPLPTAPTLLRQPPPLQQGRFLQPR

LAPNQPPPPLIRPALAASRHSARPGPQPPPTLVGAPLEPPAPSL

For any suggestions or comments, please send an email to unitrap@crg.es