Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024969 (Mark2)
Chromosomal location
Chr 19: 7349886 - 7416334 (-)
Description
MAP/microtubule affinity-regulating kinase 2 Gene [Source:MGI Symbol;Acc:MGI:99638]
RefSeq_dna
NM_001080390 NM_001080389 NM_007928 
RefSeq_peptide
NP_001073859.1 NP_001073857.1 NP_001073858.1 NP_031954.2 
UniGene
Mm.258986 
MGI
MGI:99638 
Uniprot/SWISSPROT
Q05512 
Uniprot/SPTREMBL
Q3T9A3 Q3U3A1 Q571J8 
Human Ortholog
ENSG00000072518 (MARK2)
Omim not available
UniTrap UNI3537
Vector Insertion
Chr 19: 7369928 - 7415657
Public Clones (sanger) AQ0140 (sanger) AZ0405 (sanger) XL799 (baygenomics) P141H04 (ggtc)
5SP147C08 (ggtc) 3SD142F05 (ggtc) 5SP141H04 (ggtc) 3SD081H09 (ggtc)
D069E02 (ggtc) 5SE286C04 (ggtc) 3SD069E02 (ggtc) 3SP147C08 (ggtc)
3SD141H03 (ggtc) 3SP141H04 (ggtc) D043B02 (ggtc) 3SP151H02 (ggtc)
3SE065H04 (ggtc) 5SP143D01 (ggtc) 5SD081H09 (ggtc) 5SD069E02 (ggtc)
Ayu21-T218 (egtc) IST14486A12 (tigm) IST14567C11 (tigm) IST13573B4 (tigm)
IST15002F12 (tigm) IST13200B5 (tigm) IST14497B11 (tigm) IST14956H10 (tigm)
IST14370B1 (tigm) IST14377F1 (tigm) IST14170D9 (tigm) IST10036E5 (tigm)
IST14114D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15882
Vector Insertion
Chr 19: 7365092 - 7365273
Public Clones not available
Private Clones OST471051 (lexicon) OST470995 (lexicon) OST453283 (lexicon) OST412660 (lexicon)
OST412593 (lexicon) OST400039 (lexicon) OST383062 (lexicon) OST379303 (lexicon)
OST355137 (lexicon) OST259672 (lexicon) OST250195 (lexicon) OST231692 (lexicon)
OST221914 (lexicon) OST214997 (lexicon) OST214210 (lexicon) OST204199 (lexicon)
OST195119 (lexicon) OST180346 (lexicon) OST167690 (lexicon) OST167329 (lexicon)
OST161535 (lexicon) OST157494 (lexicon) OST136622 (lexicon) OST132435 (lexicon)
OST91785 (lexicon) OST65883 (lexicon) OST61718 (lexicon) OST40063 (lexicon)
OST34764 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24312
Vector Insertion
Chr 19: 7364860 - 7365092
Public Clones not available
Private Clones OST224957 (lexicon) OST202059 (lexicon) OST192434 (lexicon) OST56690 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21159
Vector Insertion
Chr 19: 7361869 - 7364805
Public Clones (sanger)
Private Clones OST339768 (lexicon) OST299745 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13702
Vector Insertion
Chr 19: 7361557 - 7361819
Public Clones CMHD-GT_258B1-3 (cmhd)
Private Clones OST96343 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25491
Vector Insertion
Chr 19: 7361395 - 7361490
Public Clones not available
Private Clones OST181543 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2874
Vector Insertion
Chr 19: 7359479 - 7360221
Public Clones AF0004 (sanger) AG0190 (sanger) RRK203 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29966
Vector Insertion
Chr 19: 7349885 - 7352577
Public Clones D175F10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025921
Sequence
GCTCGCCCATCTCTTCCTGCTCCTTTCCTCCCAACTAACTTCTGATGTACCATCCTGGACTGTGCACTCTTTCTGACCACTCAGCCTTACCAAGCCATAG

GCTTTGTCCCTGTAGCTCTCTCTGCCAAACCCAGTCTCTCTCTTTCTGTTAGTGGTGGTTTCGGTTGCGACACAGTCTAGGTTCTCAGGCGGGAACTGCT

CTGCCTGCCTGCTACGCTTTTTACTGAGGAGGTGGTGGAAGGTGTCGCCTGGCCTGTGCCGGCTGAGTAAGGGTGGCTGGCTGAGCCGGCAGCCCCCGCC

CTGGGCCTGGCTCATCCCGGTCTCTGTACTTTGCCCTCGCTGCCTGACAGGTTCTGCTGAATGGAAGTCGCTGGTAGTCCTTGTCCCCTTCTCCGGCTGG

 - UNI15882 - CCCACCTTGGGACACCTTGATTCCAAGCCCAGCAGTAAGTCCAACATGCTGCGGGGCCGCAACTCAGCCACCTCTGCTGACGAGCA

GCCCCATATTGGCAACTACCGGCTCCTTAAGACCATTGGCAAGGGTAACTTTGCCAAGGTGAAGTTGGCCCGGCACATCCTGACGGGGAAAGAG - UNI

15882 - - UNI24312 - GTAGCTGTGAAGATCATCGACAAGACCCAGCTGAACTCCTCCAGCCTACAGAAA - UNI21159 - CTGTTCCGAGA

AGTAAGAATAATGAAGGTTTTGAATCATCCCAACATAG - UNI13702 - TTAAGTTGTTTGAAGTGATCGAGACTGAGAAGACTCTCTACCTTGTCA

TGGAGTATGCCAGTGGCG - UNI25491 - GAGAGGTGTTTGATTACCTAGTGGCCCATGGCAGGATGAAAGAAAAAGAAGCTCGAGCCAAATTTCGC

CAG ATAGTGTCTGCTGTGCAGTACTGTCACCAGAAGTTCATTGTTCATAGAGATCTAAAG GCAGAAAACCTGCTCCTGGATGCTGATATGAACATCAA

GATTGCAGACTTTGGCTTTAGCAACGAATTCACCTTTGGGAACAAGCTGGATACTTTCTGTGGCAGTCCTCCTTATGCTGCCCCAGAACTTTTCCAGGGC

AAAAAGTATGATGGTCCTGAGGTGGATGTCTGGAGCCTGGGAGTCATCCTCTATACACTGGTCAGCGGATCCCTGCCTTTTGATGGACAGAACCTCAAG 

- UNI2874 - GAGCTGCGGGAACGGGTACTGAGGGGGAAATACCGTATTCCGTTCTACATGTCCACGGACTGTGAAAATCTGCTTAAGAAATTTCTCA

TACTTAATCCTAGTAAGAGAGGCACTTTAGAG CAAATTATGAAAGATCGGTGGATGAACGTGGGGCATGAGGACGATGAGCTAAAGCCTTATGTGGAAC

CTCTCCCTGACTACAAGGACCCCCGGCGGACAG AGTTGATGGTGTCAATGGGTTACACACGGGAAGAGATCCAGGACTCGCTGGTAGGCCAGAGGTACA

ACGAAGTGATGGCTACCTATCTGCTCCTTGGCTACAAGAGCTCTGAG CTGGAAGGTGATACCATCACTTTGAAGCCCCGGCCTTCAGCTGATCTAACCA

ACAGCAGTGCCCCATCTCCATCCCACAAGGTTCAGCGCAGCGTCTCTGCCAACCCCAAGCAACGACGCTCCAGTGACCAGG CCGTCCCTGCCATTCCCA

CCTCGAATTCCTACTCTAAGAAGACTCAGAGTAACAACGCAGAAAATAAGCGGCCTGAGGAAGAGACAGGGCGGAAAGCCAGCAGCACCGCCAAAGTGCC

TGCCAGCCCTCTGCCTGGCCTGGACAGGAAGAAGACCACTCCTGCCCCCTCCACG AACAGCGTCCTTTCCACCAGCACAAACCGAAGCAGGAACTCCCC

ACTTTTGGACAGGGCCAGCCTTGGCCAGGCCTCCATCCAGAATGGTAAAGACAG CCTAACCATGCCAGGGTCCCGGGCCTCCACGGCTTCTGCTTCTGC

CGCAGTCTCTGCGGCCCGGCCCCGCCAGCACCAGAAATCCATGTCTGCCTCCGTACACCCCAACAAGGCCTCTGGGTTGCCCCCCACGGAGAGTAACTGT

GAGGTGCCTCGGCCCAG CACAGCCCCCCAGCGCGTCCCTGTCGCCTCCCCCTCCGCCCACAACATCAGCAGCAGTAGTGGAGCCCCAGACCGAACTAAT

TTCCCACGGGGTGTGTCCAGTCGAAGCACCTTCCATGCTGGGCAGCTCCGACAGGTGCGGGACCAGCAGAATCTACCCTACGGTGTGACCCCAGCCTCTC

CCTCTGGCCATAGCCAGGGCCGGCGGGGGGCCTCTGGCAGCATCTTCAGCAAGTTCACCTCCAAGTTTGTCCGCAG - UNI29966 - GAACCTGAAT

GAACCTGAAAGCAAAGACCGAGTGGAGACGCTCAG - UNI29966 - ACCTCACGTGGTAGGCAGTGGAGGCACTGACAAGGACAAGGAGGAGTTTCG

GGAGGCCAAGCCTCGCTCCCTGCGCTTCACCTGGAGCATGAAGACCACGAGCTCTATGGAGCCCAATGAGATGATGCGGGAGATCCGCAAGGTGCTGGAC

GCCAACAGCTGCCAAAGCGAGCTGCACGAGCGGTACATGCTACTGTGCGTGCATGGCACACCAGGCCACGAGAACTTTGTGCAGTGGGAGATGGAGGTGT

GCAAACTGCCCCGGCTGTCTCTCAACGGTGTTCGGTTTAAGCGGATATCGGGCACTTCCATGGCCTTCAAAAACATTGCCTCCAAAATAGCCAATGAGCT

GAAGCTTTAACAGGCTGTCAGGAGGGGCAGCAGAGGCCCACCAGTGGACTTGGCTGCTTGGGCCAACCCTGCATCCCCCTGGGAGAAACTGCAGGATGAA

TTGGTGTGTCTCCCCTGCTGGCACTTGTCCCCTTCCAGGCCCTTCTCAGTTTTTTTCTTCCATGTTTGTGGGGGATGGGAAGTGGTTCTTCTCCCTCCCA

CATTCACCCCTGCCCAGAAGTCCCTCCCTTCCCCCCTGCAGGAGGCAAAGGAAGGGGAGGGGGCTGGGGGGGGGCAGGGCTCCCCCTCGGTACTGCGGTT

GCACAGAGTATTTCGCCTAAACCAAGAAAATTTTTATTACCAAAAAAGAAAAAGAAAAAAAAAAAAATCCCAGCGGCCACCTTTCCTCCCTGCCCCATTG

GGACAGTCAAGACTGGATCTGTGGGGCTCCTGGGAGGGTGGCTCAGGGCTGGAACACTCTCAGGCAAGAGTGGTGGAGTTCCCTGGCAGGCCCTCCGCCA

GGCCCTCTTTGGGCTTCTCCCCTCTCCCCACTTCTTCCCCCCTTCAAGCGACCCACCAGAGGTGGCCTTCCCCTGCCCCCAAGCCCTTGGGCTTACAGGC

CTTTACACTGAGGCCCAGTTGGGGGTACTGCACAGCCCTGGAGAGGGTGGGCGGTGGGACCCTGGCTCCCTCCACACCATATCCTCTGTCCTTCCCCAGA

GCTGGGCACTTCCTTCCATGAGCTGCTGTGGGGACATGGTTCCCCTTCTCAGAAGTCTGTGCCATCTTCAGGCAGGCTAAACCCAGTACTGGTAGAGGGG

AGGGGAATGGGCCATGGGCTCTCAGCCCCCAGGGGGCAGCTTGGGAACAGGGACACAGCTTCTCCGTTCTGGGAGTCTTTGTCTGAAAGCACAGCCCCTC

ACCATCCCCCTACTGCTTCCCCTTCCTTGGCATTAATCTGGGCACCGTTCTCATCTCACAGCCTTGCCTTTTCTTCCTGGCATTGCCGCCCCTCCTCTCA

GGAGACTGTCCAGGGCCTCCATGGCTGCCTGGCGGAAGGCTGGATTGGGCGGCAGGGCCAGGAGTCTCTTGTCCTCCACAGGGTGGGGCAAAGTAACTCC

TGCTTGCTAACCTCTGAGGCCAGTGTGTGAATGGGTGGCTGTAGGCGCTTGGCTGGTGGTGGCCACTGCATCCCTTAATTTATTTCTCTGCTGTTTCAGT

TCTTGAGAAATTGGGGAAGTCCTACAGAGGCTGCCCCTGCCCTCACCTGAGTTGTACATTTTTTTTGTGATGGGTTATTTTTTATTTTTATTATTATTGT

TGTTTTGGTTTTTTTTTTGTTTGTTTTTGATTTATGACAATTCCACTCTTGGCCCCAGTTGTCGTCCTGTCACTCCCTCCCCTGTCCATCACCCTGGCTC

CCAGACCAGGCTCAGCAACACATTGAGTCTTGGGTTCCAGGAACCTTGCCAACCTCAACCCTCCAGCCCGTGCTCCACTGGCTATGGCTCAGACCAAGGG

CTCCTCCTCTCCCCTCTTGCCCTATGGAACAGCCCGGGTGCTCCAAGGGGGCCAGGAGGGCATGGCTTGGCTCCCAAGATAAGGGGTCCGGGGCCAGGAC

ACCCAGGCAAGGTGGCCCCTCCCTGCCTAGCCCCCTTCCCCCCACCCTGCACTTAGTTTCTCCTCTGGATCAAATACGTAATAAAGAGAATGTTTGGAAT

CTGA
Translation
 - UNI15882 - MLRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGKE - UNI15882 - - UNI24312 - VAVKIIDKTQLNSS

SLQK - UNI21159 - LFREVRIMKVLNHPNIV - UNI13702 - VKLFEVIETEKTLYLVMEYASGG - UNI25491 - GEVFDYLVAHGRMK

EKEARAKFRQ IVSAVQYCHQKFIVHRDLK AENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSG

SLPFDGQNLK - UNI2874 - ELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLE QIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTE E

LMVSMGYTREEIQDSLVGQRYNEVMATYLLLGYKSSE LEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRSSDQA AVPAIPTSNSYSKKTQ

SNNAENKRPEEETGRKASSTAKVPASPLPGLDRKKTTPAPST NSVLSTSTNRSRNSPLLDRASLGQASIQNGKDS SLTMPGSRASTASASAAVSAARP

RQHQKSMSASVHPNKASGLPPTESNCEVPRPS STAPQRVPVASPSAHNISSSSGAPDRTNFPRGVSSRSTFHAGQLRQVRDQQNLPYGVTPASPSGHSQ

GRRGASGSIFSKFTSKFVRR - UNI29966 - RNLNEPESKDRVETLR - UNI29966 - RPHVVGSGGTDKDKEEFREAKPRSLRFTWSMKTTSS

MEPNEMMREIRKVLDANSCQSELHERYMLLCVHGTPGHENFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIASKIANELKL
Transcript ENSMUST00000032557
Sequence
GTTGGCTCTGGAGGTGCGGGGAGTCTCTTCGTGGATTTCCGTAAACAGAGCCGAACCTCGGTCTTCGGAATCTAGGAGGTGCGCGCGTCCCCGGGGATTA

CCTTCTTCGGTAGTTTCCGGAATTCACCCATCGTCTGGGCCGAGAGGAAAAGGCTCTTCCCCCTCCCGTTCCTAGTTGTTTCGGATGTTTCCGGCTCTTG

CCGGCGGAAAGAGCCGAGGGCTGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGTCGGGCGCGGAGCAGTGCGGCTG

AGGGCAGGGGAGGAGCGAGGCAGGCGGCCGGCTGCGGCGGTTGAGAGTAGGCGGAGCGGCGCGGCCGGGCCGAAAGGCGGCACAACCCAGCCGGGGGTCG

GGGGGGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGAGGCCTAGCCCGAGCGGTGCATCACCGGGCTGGCGTGAGCCATCGCCCGGCCTCCCCGCACC

CCCGGCCGGGGCCCATGCAGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCTAGCCTTCCCTTCCCTATCTTCCTCCAAGCTTCTCCATT

CCCTCCCCTGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAAAGGGACACGGAGCAG - UNI3537 - - UNI15882

 - CCCACCTTGGGACACCTTGATTCCAAGCCCAGCAGTAAGTCCAACATGCTGCGGGGCCGCAACTCAGCCACCTCTGCTGACGAGCAGCCCCATATTG

GCAACTACCGGCTCCTTAAGACCATTGGCAAGGGTAACTTTGCCAAGGTGAAGTTGGCCCGGCACATCCTGACGGGGAAAGAG - UNI15882 - - U

NI24312 - GTAGCTGTGAAGATCATCGACAAGACCCAGCTGAACTCCTCCAGCCTACAGAAA - UNI21159 - CTGTTCCGAGAAGTAAGAATAA

TGAAGGTTTTGAATCATCCCAACATAG - UNI13702 - TTAAGTTGTTTGAAGTGATCGAGACTGAGAAGACTCTCTACCTTGTCATGGAGTATGCC

AGTGGCG - UNI25491 - GAGAGGTGTTTGATTACCTAGTGGCCCATGGCAGGATGAAAGAAAAAGAAGCTCGAGCCAAATTTCGCCAG ATAGTGT

CTGCTGTGCAGTACTGTCACCAGAAGTTCATTGTTCATAGAGATCTAAAG GCAGAAAACCTGCTCCTGGATGCTGATATGAACATCAAGATTGCAGACT

TTGGCTTTAGCAACGAATTCACCTTTGGGAACAAGCTGGATACTTTCTGTGGCAGTCCTCCTTATGCTGCCCCAGAACTTTTCCAGGGCAAAAAGTATGA

TGGTCCTGAGGTGGATGTCTGGAGCCTGGGAGTCATCCTCTATACACTGGTCAGCGGATCCCTGCCTTTTGATGGACAGAACCTCAAG - UNI2874 -

 GAGCTGCGGGAACGGGTACTGAGGGGGAAATACCGTATTCCGTTCTACATGTCCACGGACTGTGAAAATCTGCTTAAGAAATTTCTCATACTTAATCCT

AGTAAGAGAGGCACTTTAGAG CAAATTATGAAAGATCGGTGGATGAACGTGGGGCATGAGGACGATGAGCTAAAGCCTTATGTGGAACCTCTCCCTGAC

TACAAGGACCCCCGGCGGACAG AGTTGATGGTGTCAATGGGTTACACACGGGAAGAGATCCAGGACTCGCTGGTAGGCCAGAGGTACAACGAAGTGATG

GCTACCTATCTGCTCCTTGGCTACAAGAGCTCTGAG CTGGAAGGTGATACCATCACTTTGAAGCCCCGGCCTTCAGCTGATCTAACCAACAGCAGTGCC

CCATCTCCATCCCACAAGGTTCAGCGCAGCGTCTCTGCCAACCCCAAGCAACGACGCTCCAGTGACCAGG CCGTCCCTGCCATTCCCACCTCGAATTCC

TACTCTAAGAAGACTCAGAGTAACAACGCAGAAAATAAGCGGCCTGAGGAAGAGACAGGGCGGAAAGCCAGCAGCACCGCCAAAGTGCCTGCCAGCCCTC

TGCCTGGCCTGGACAGGAAGAAGACCACTCCTGCCCCCTCCACG AACAGCGTCCTTTCCACCAGCACAAACCGAAGCAGGAACTCCCCACTTTTGGACA

GGGCCAGCCTTGGCCAGGCCTCCATCCAGAATGGTAAAGACAG CACAGCCCCCCAGCGCGTCCCTGTCGCCTCCCCCTCCGCCCACAACATCAGCAGCA

GTAGTGGAGCCCCAGACCGAACTAATTTCCCACGGGGTGTGTCCAGTCGAAGCACCTTCCATGCTGGGCAGCTCCGACAGGTGCGGGACCAGCAGAATCT

ACCCTACGGTGTGACCCCAGCCTCTCCCTCTGGCCATAGCCAGGGCCGGCGGGGGGCCTCTGGCAGCATCTTCAGCAAGTTCACCTCCAAGTTTGTCCGC

AG AAATCTGTCTTTCAGGTTTGCCAGAAG - UNI29966 - GAACCTGAATGAACCTGAAAGCAAAGACCGAGTGGAGACGCTCAG - UNI29966

 - ACCTCACGTGGTAGGCAGTGGAGGCACTGACAAGGACAAGGAGGAGTTTCGGGAGGCCAAGCCTCGCTCCCTGCGCTTCACCTGGAGCATGAAGACC

ACGAGCTCTATGGAGCCCAATGAGATGATGCGGGAGATCCGCAAGGTGCTGGACGCCAACAGCTGCCAAAGCGAGCTGCACGAGCGGTACATGCTACTGT

GCGTGCATGGCACACCAGGCCACGAGAACTTTGTGCAGTGGGAGATGGAGGTGTGCAAACTGCCCCGGCTGTCTCTCAACGGTGTTCGGTTTAAGCGGAT

ATCGGGCACTTCCATGGCCTTCAAAAACATTGCCTCCAAAATAGCCAATGAGCTGAAGCTTTAACAGGCTGTCAGGAGGGGCAGCAGAGGCCCACCAGTG

GACTTGGCTGCTTGGGCCAACCCTGCATCCCCCTGGGAGAAACTGCAGGATGAATTGGTGTGTCTCCCCTGCTGGCACTTGTCCCCTTCCAGGCCCTTCT

CAGTTTTTTTCTTCCATGTTTGTGGGGGATGGGAAGTGGTTCTTCTCCCTCCCACATTCACCCCTGCCCAGAAGTCCCTCCCTTCCCCCCTGCAGGAGGC

AAAGGAAGGGGAGGGGGCTGGGGGGGGGCAGGGCTCCCCCTCGGTACTGCGGTTGCACAGAGTATTTCGCCTAAACCAAGAAAATTTTTATTACCAAAAA

AGAAAAAGAAAAAAAAAAAAATCCCAGCGGCCACCTTTCCTCCCTGCCCCATTGGGACAGTCAAGACTGGATCTGTGGGGCTCCTGGGAGGGTGGCTCAG

GGCTGGAACACTCTCAGGCAAGAGTGGTGGAGTTCCCTGGCAGGCCCTCCGCCAGGCCCTCTTTGGGCTTCTCCCCTCTCCCCACTTCTTCCCCCCTTCA

AGCGACCCACCAGAGGTGGCCTTCCCCTGCCCCCAAGCCCTTGGGCTTACAGGCCTTTACACTGAGGCCCAGTTGGGGGTACTGCACAGCCCTGGAGAGG

GTGGGCGGTGGGACCCTGGCTCCCTCCACACCATATCCTCTGTCCTTCCCCAGAGCTGGGCACTTCCTTCCATGAGCTGCTGTGGGGACATGGTTCCCCT

TCTCAGAAGTCTGTGCCATCTTCAGGCAGGCTAAACCCAGTACTGGTAGAGGGGAGGGGAATGGGCCATGGGCTCTCAGCCCCCAGGGGGCAGCTTGGGA

ACAGGGACACAGCTTCTCCGTTCTGGGAGTCTTTGTCTGAAAGCACAGCCCCTCACCATCCCCCTACTGCTTCCCCTTCCTTGGCATTAATCTGGGCACC

GTTCTCATCTCACAGCCTTGCCTTTTCTTCCTGGCATTGCCGCCCCTCCTCTCAGGAGACTGTCCAGGGCCTCCATGGCTGCCTGGCGGAAGGCTGGATT

GGGCGGCAGGGCCAGGAGTCTCTTGTCCTCCACAGGGTGGGGCAAAGTAACTCCTGCTTGCTAACCTCTGAGGCCAGTGTGTGAATGGGTGGCTGTAGGC

GCTTGGCTGGTGGTGGCCACTGCATCCCTTAATTTATTTCTCTGCTGTTTCAGTTCTTGAGAAATTGGGGAAGTCCTACAGAGGCTGCCCCTGCCCTCAC

CTGAGTTGTACATTTTTTTTGTGATGGGTTATTTTTTATTTTTATTATTATTGTTGTTTTGGTTTTTTTTTTGTTTGTTTTTGATTTATGACAATTCCAC

TCTTGGCCCCAGTTGTCGTCCTGTCACTCCCTCCCCTGTCCATCACCCTGGCTCCCAGACCAGGCTCAGCAACACATTGAGTCTTGGGTTCCAGGAACCT

TGCCAACCTCAACCCTCCAGCCCGTGCTCCACTGGCTATGGCTCAGACCAAGGGCTCCTCCTCTCCCCTCTTGCCCTATGGAACAGCCCGGGTGCTCCAA

GGGGGCCAGGAGGGCATGGCTTGGCTCCCAAGATAAGGGGTCCGGGGCCAGGACACCCAGGCAAGGTGGCCCCTCCCTGCCTAGCCCCCTTCCCCCCACC

CTGCACTTAGTTTCTCCTCTGGATCAAATACGTAATAAAGAGAATGTTTGGAATCTGA
Translation
MSSARTPLPTLNERDTEQ - UNI3537 - - UNI15882 - PTLGHLDSKPSSKSNMLRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLARHIL

TGKE - UNI15882 - - UNI24312 - VAVKIIDKTQLNSSSLQK - UNI21159 - LFREVRIMKVLNHPNIV - UNI13702 - VKLFEV

IETEKTLYLVMEYASGG - UNI25491 - GEVFDYLVAHGRMKEKEARAKFRQ IVSAVQYCHQKFIVHRDLK AENLLLDADMNIKIADFGFSNEFT

FGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLK - UNI2874 - ELRERVLRGKYRIPFYMSTDCENLLKKFLILN

PSKRGTLE QIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTE ELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGYKSSE LEGDTITLKPRPSADLT

NSSAPSPSHKVQRSVSANPKQRRSSDQA AVPAIPTSNSYSKKTQSNNAENKRPEEETGRKASSTAKVPASPLPGLDRKKTTPAPST NSVLSTSTNRSR

NSPLLDRASLGQASIQNGKDS STAPQRVPVASPSAHNISSSSGAPDRTNFPRGVSSRSTFHAGQLRQVRDQQNLPYGVTPASPSGHSQGRRGASGSIFS

KFTSKFVRR RNLSFRFARR - UNI29966 - RNLNEPESKDRVETLR - UNI29966 - RPHVVGSGGTDKDKEEFREAKPRSLRFTWSMKTTSS

MEPNEMMREIRKVLDANSCQSELHERYMLLCVHGTPGHENFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIASKIANELKL
Transcript ENSMUST00000032556
Sequence
GTTGGCTCTGGAGGTGCGGGGAGTCTCTTCGTGGATTTCCGTAAACAGAGCCGAACCTCGGTCTTCGGAATCTAGGAGGTGCGCGCGTCCCCGGGGATTA

CCTTCTTCGGTAGTTTCCGGAATTCACCCATCGTCTGGGCCGAGAGGAAAAGGCTCTTCCCCCTCCCGTTCCTAGTTGTTTCGGATGTTTCCGGCTCTTG

CCGGCGGAAAGAGCCGAGGGCTGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGTCGGGCGCGGAGCAGTGCGGCTG

AGGGCAGGGGAGGAGCGAGGCAGGCGGCCGGCTGCGGCGGTTGAGAGTAGGCGGAGCGGCGCGGCCGGGCCGAAAGGCGGCACAACCCAGCCGGGGGTCG

GGGGGGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGAGGCCTAGCCCGAGCGGTGCATCACCGGGCTGGCGTGAGCCATCGCCCGGCCTCCCCGCACC

CCCGGCCGGGGCCCATGCAGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCTAGCCTTCCCTTCCCTATCTTCCTCCAAGCTTCTCCATT

CCCTCCCCTGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAAAGGGACACGGAGCAG - UNI3537 - - UNI15882

 - CCCACCTTGGGACACCTTGATTCCAAGCCCAGCAGTAAGTCCAACATGCTGCGGGGCCGCAACTCAGCCACCTCTGCTGACGAGCAGCCCCATATTG

GCAACTACCGGCTCCTTAAGACCATTGGCAAGGGTAACTTTGCCAAGGTGAAGTTGGCCCGGCACATCCTGACGGGGAAAGAG - UNI15882 - - U

NI24312 - GTAGCTGTGAAGATCATCGACAAGACCCAGCTGAACTCCTCCAGCCTACAGAAA - UNI21159 - CTGTTCCGAGAAGTAAGAATAA

TGAAGGTTTTGAATCATCCCAACATAG - UNI13702 - TTAAGTTGTTTGAAGTGATCGAGACTGAGAAGACTCTCTACCTTGTCATGGAGTATGCC

AGTGGCG - UNI25491 - GAGAGGTGTTTGATTACCTAGTGGCCCATGGCAGGATGAAAGAAAAAGAAGCTCGAGCCAAATTTCGCCAG ATAGTGT

CTGCTGTGCAGTACTGTCACCAGAAGTTCATTGTTCATAGAGATCTAAAG GCAGAAAACCTGCTCCTGGATGCTGATATGAACATCAAGATTGCAGACT

TTGGCTTTAGCAACGAATTCACCTTTGGGAACAAGCTGGATACTTTCTGTGGCAGTCCTCCTTATGCTGCCCCAGAACTTTTCCAGGGCAAAAAGTATGA

TGGTCCTGAGGTGGATGTCTGGAGCCTGGGAGTCATCCTCTATACACTGGTCAGCGGATCCCTGCCTTTTGATGGACAGAACCTCAAG - UNI2874 -

 GAGCTGCGGGAACGGGTACTGAGGGGGAAATACCGTATTCCGTTCTACATGTCCACGGACTGTGAAAATCTGCTTAAGAAATTTCTCATACTTAATCCT

AGTAAGAGAGGCACTTTAGAG CAAATTATGAAAGATCGGTGGATGAACGTGGGGCATGAGGACGATGAGCTAAAGCCTTATGTGGAACCTCTCC CCTC

CCCTCCCCCAACCACCAGAGTTGATGGTGTCAATGGGTTACAC GAAGAGATCCAGGACTCGCTGGTAGGCCAGAGGTACAACGAAGTGATGGCTACCTA

TCTGCTCCTTGGCTACAAGAGCTCTGAG CTGGAAGGTGATACCATCACTTTGAAGCCCCGGCCTTCAGCTGATCTAACCAACAGCAGTGCCCCATCTCC

ATCCCACAAGGTTCAGCGCAGCGTCTCTGCCAACCCCAAGCAACGACGCTCCAGTGACCAGG CCGTCCCTGCCATTCCCACCTCGAATTCCTACTCTAA

GAAGACTCAGAGTAACAACGCAGAAAATAAGCGGCCTGAGGAAGAGACAGGGCGGAAAGCCAGCAGCACCGCCAAAGTGCCTGCCAGCCCTCTGCCTGGC

CTGGACAGGAAGAAGACCACTCCTGCCCCCTCCACG AACAGCGTCCTTTCCACCAGCACAAACCGAAGCAGGAACTCCCCACTTTTGGACAGGGCCAGC

CTTGGCCAGGCCTCCATCCAGAATGGTAAAGACAG CCTAACCATGCCAGGGTCCCGGGCCTCCACGGCTTCTGCTTCTGCCGCAGTCTCTGCGGCCCGG

CCCCGCCAGCACCAGAAATCCATGTCTGCCTCCGTACACCCCAACAAGGCCTCTGGGTTGCCCCCCACGGAGAGTAACTGTGAGGTGCCTCGGCCCAG C

ACAGCCCCCCAGCGCGTCCCTGTCGCCTCCCCCTCCGCCCACAACATCAGCAGCAGTAGTGGAGCCCCAGACCGAACTAATTTCCCACGGGGTGTGTCCA

GTCGAAGCACCTTCCATGCTGGGCAGCTCCGACAGGTGCGGGACCAGCAGAATCTACCCTACGGTGTGACCCCAGCCTCTCCCTCTGGCCATAGCCAGGG

CCGGCGGGGGGCCTCTGGCAGCATCTTCAGCAAGTTCACCTCCAAGTTTGTCCGCAG - UNI29966 - GAACCTGAATGAACCTGAAAGCAAAGACC

GAGTGGAGACGCTCAG - UNI29966 - ACCTCACGTGGTAGGCAGTGGAGGCACTGACAAGGACAAGGAGGAGTTTCGGGAGGCCAAGCCTCGCTCC

CTGCGCTTCACCTGGAGCATGAAGACCACGAGCTCTATGGAGCCCAATGAGATGATGCGGGAGATCCGCAAGGTGCTGGACGCCAACAGCTGCCAAAGCG

AGCTGCACGAGCGGTACATGCTACTGTGCGTGCATGGCACACCAGGCCACGAGAACTTTGTGCAGTGGGAGATGGAGGTGTGCAAACTGCCCCGGCTGTC

TCTCAACGGTGTTCGGTTTAAGCGGATATCGGGCACTTCCATGGCCTTCAAAAACATTGCCTCCAAAATAGCCAATGAGCTGAAGCTTTAACAGGCTGTC

AGGAGGGGCAGCAGAGGCCCACCAGTGGACTTGGCTGCTTGGGCCAACCCTGCATCCCCCTGGGAGAAACTGCAGGATGAATTGGTGTGTCTCCCCTGCT

GGCACTTGTCCCCTTCCAGGCCCTTCTCAGTTTTTTTCTTCCATGTTTGTGGGGGATGGGAAGTGGTTCTTCTCCCTCCCACATTCACCCCTGCCCAGAA

GTCCCTCCCTTCCCCCCTGCAGGAGGCAAAGGAAGGGGAGGGGGCTGGGGGGGGGCAGGGCTCCCCCTCGGTACTGCGGTTGCACAGAGTATTTCGCCTA

AACCAAGAAAATTTTTATTACCAAAAAAGAAAAAGAAAAAAAAAAAAATCCCAGCGGCCACCTTTCCTCCCTGCCCCATTGGGACAGTCAAGACTGGATC

TGTGGGGCTCCTGGGAGGGTGGCTCAGGGCTGGAACACTCTCAGGCAAGAGTGGTGGAGTTCCCTGGCAGGCCCTCCGCCAGGCCCTCTTTGGGCTTCTC

CCCTCTCCCCACTTCTTCCCCCCTTCAAGCGACCCACCAGAGGTGGCCTTCCCCTGCCCCCAAGCCCTTGGGCTTACAGGCCTTTACACTGAGGCCCAGT

TGGGGGTACTGCACAGCCCTGGAGAGGGTGGGCGGTGGGACCCTGGCTCCCTCCACACCATATCCTCTGTCCTTCCCCAGAGCTGGGCACTTCCTTCCAT

GAGCTGCTGTGGGGACATGGTTCCCCTTCTCAGAAGTCTGTGCCATCTTCAGGCAGGCTAAACCCAGTACTGGTAGAGGGGAGGGGAATGGGCCATGGGC

TCTCAGCCCCCAGGGGGCAGCTTGGGAACAGGGACACAGCTTCTCCGTTCTGGGAGTCTTTGTCTGAAAGCACAGCCCCTCACCATCCCCCTACTGCTTC

CCCTTCCTTGGCATTAATCTGGGCACCGTTCTCATCTCACAGCCTTGCCTTTTCTTCCTGGCATTGCCGCCCCTCCTCTCAGGAGACTGTCCAGGGCCTC

CATGGCTGCCTGGCGGAAGGCTGGATTGGGCGGCAGGGCCAGGAGTCTCTTGTCCTCCACAGGGTGGGGCAAAGTAACTCCTGCTTGCTAACCTCTGAGG

CCAGTGTGTGAATGGGTGGCTGTAGGCGCTTGGCTGGTGGTGGCCACTGCATCCCTTAATTTATTTCTCTGCTGTTTCAGTTCTTGAGAAATTGGGGAAG

TCCTACAGAGGCTGCCCCTGCCCTCACCTGAGTTGTACATTTTTTTTGTGATGGGTTATTTTTTATTTTTATTATTATTGTTGTTTTGGTTTTTTTTTTG

TTTGTTTTTGATTTATGACAATTCCACTCTTGGCCCCAGTTGTCGTCCTGTCACTCCCTCCCCTGTCCATCACCCTGGCTCCCAGACCAGGCTCAGCAAC

ACATTGAGTCTTGGGTTCCAGGAACCTTGCCAACCTCAACCCTCCAGCCCGTGCTCCACTGGCTATGGCTCAGACCAAGGGCTCCTCCTCTCCCCTCTTG

CCCTATGGAACAGCCCGGGTGCTCCAAGGGGGCCAGGAGGGCATGGCTTGGCTCCCAAGATAAGGGGTCCGGGGCCAGGACACCCAGGCAAGGTGGCCCC

TCCCTGCCTAGCCCCCTTCCCCCCACCCTGCACTTAGTTTCTCCTCTGGATCAAATACGTAATAAAGAGAATGTTTGGAATCTGA
Translation
MSSARTPLPTLNERDTEQ - UNI3537 - - UNI15882 - PTLGHLDSKPSSKSNMLRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLARHIL

TGKE - UNI15882 - - UNI24312 - VAVKIIDKTQLNSSSLQK - UNI21159 - LFREVRIMKVLNHPNIV - UNI13702 - VKLFEV

IETEKTLYLVMEYASGG - UNI25491 - GEVFDYLVAHGRMKEKEARAKFRQ IVSAVQYCHQKFIVHRDLK AENLLLDADMNIKIADFGFSNEFT

FGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLK - UNI2874 - ELRERVLRGKYRIPFYMSTDCENLLKKFLILN

PSKRGTLE QIMKDRWMNVGHEDDELKPYVEPLP PSPPPTTRVDGVNGLH EEIQDSLVGQRYNEVMATYLLLGYKSSE LEGDTITLKPRPSADLTNS

SAPSPSHKVQRSVSANPKQRRSSDQA AVPAIPTSNSYSKKTQSNNAENKRPEEETGRKASSTAKVPASPLPGLDRKKTTPAPST NSVLSTSTNRSRNS

PLLDRASLGQASIQNGKDS SLTMPGSRASTASASAAVSAARPRQHQKSMSASVHPNKASGLPPTESNCEVPRPS STAPQRVPVASPSAHNISSSSGAP

DRTNFPRGVSSRSTFHAGQLRQVRDQQNLPYGVTPASPSGHSQGRRGASGSIFSKFTSKFVRR - UNI29966 - RNLNEPESKDRVETLR - UNI2

9966 - RPHVVGSGGTDKDKEEFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHERYMLLCVHGTPGHENFVQWEMEVCKLPRLSLN

GVRFKRISGTSMAFKNIASKIANELKL
Transcript ENSMUST00000051711
Sequence
GTTGGCTCTGGAGGTGCGGGGAGTCTCTTCGTGGATTTCCGTAAACAGAGCCGAACCTCGGTCTTCGGAATCTAGGAGGTGCGCGCGTCCCCGGGGATTA

CCTTCTTCGGTAGTTTCCGGAATTCACCCATCGTCTGGGCCGAGAGGAAAAGGCTCTTCCCCCTCCCGTTCCTAGTTGTTTCGGATGTTTCCGGCTCTTG

CCGGCGGAAAGAGCCGAGGGCTGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGTCGGGCGCGGAGCAGTGCGGCTG

AGGGCAGGGGAGGAGCGAGGCAGGCGGCCGGCTGCGGCGGTTGAGAGTAGGCGGAGCGGCGCGGCCGGGCCGAAAGGCGGCACAACCCAGCCGGGGGTCG

GGGGGGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGAGGCCTAGCCCGAGCGGTGCATCACCGGGCTGGCGTGAGCCATCGCCCGGCCTCCCCGCACC

CCCGGCCGGGGCCCATGCAGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCTAGCCTTCCCTTCCCTATCTTCCTCCAAGCTTCTCCATT

CCCTCCCCTGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAAAGGGACACGGAGCAG - UNI3537 - - UNI15882

 - CCCACCTTGGGACACCTTGATTCCAAGCCCAGCAGTAAGTCCAACATGCTGCGGGGCCGCAACTCAGCCACCTCTGCTGACGAGCAGCCCCATATTG

GCAACTACCGGCTCCTTAAGACCATTGGCAAGGGTAACTTTGCCAAGGTGAAGTTGGCCCGGCACATCCTGACGGGGAAAGAG - UNI15882 - - U

NI24312 - GTAGCTGTGAAGATCATCGACAAGACCCAGCTGAACTCCTCCAGCCTACAGAAA - UNI21159 - CTGTTCCGAGAAGTAAGAATAA

TGAAGGTTTTGAATCATCCCAACATAG - UNI13702 - TTAAGTTGTTTGAAGTGATCGAGACTGAGAAGACTCTCTACCTTGTCATGGAGTATGCC

AGTGGCG - UNI25491 - GAGAGGTGTTTGATTACCTAGTGGCCCATGGCAGGATGAAAGAAAAAGAAGCTCGAGCCAAATTTCGCCAG ATAGTGT

CTGCTGTGCAGTACTGTCACCAGAAGTTCATTGTTCATAGAGATCTAAAG GCAGAAAACCTGCTCCTGGATGCTGATATGAACATCAAGATTGCAGACT

TTGGCTTTAGCAACGAATTCACCTTTGGGAACAAGCTGGATACTTTCTGTGGCAGTCCTCCTTATGCTGCCCCAGAACTTTTCCAGGGCAAAAAGTATGA

TGGTCCTGAGGTGGATGTCTGGAGCCTGGGAGTCATCCTCTATACACTGGTCAGCGGATCCCTGCCTTTTGATGGACAGAACCTCAAG - UNI2874 -

 GAGCTGCGGGAACGGGTACTGAGGGGGAAATACCGTATTCCGTTCTACATGTCCACGGACTGTGAAAATCTGCTTAAGAAATTTCTCATACTTAATCCT

AGTAAGAGAGGCACTTTAGAG CAAATTATGAAAGATCGGTGGATGAACGTGGGGCATGAGGACGATGAGCTAAAGCCTTATGTGGAACCTCTCCCTGAC

TACAAGGACCCCCGGCGGACAG AGTTGATGGTGTCAATGGGTTACACACGGGAAGAGATCCAGGACTCGCTGGTAGGCCAGAGGTACAACGAAGTGATG

GCTACCTATCTGCTCCTTGGCTACAAGAGCTCTGAG CTGGAAGGTGATACCATCACTTTGAAGCCCCGGCCTTCAGCTGATCTAACCAACAGCAGTGCC

CCATCTCCATCCCACAAGGTTCAGCGCAGCGTCTCTGCCAACCCCAAGCAACGACGCTCCAGTGACCAGG CCGTCCCTGCCATTCCCACCTCGAATTCC

TACTCTAAGAAGACTCAGAGTAACAACGCAGAAAATAAGCGGCCTGAGGAAGAGACAGGGCGGAAAGCCAGCAGCACCGCCAAAGTGCCTGCCAGCCCTC

TGCCTGGCCTGGACAGGAAGAAGACCACTCCTGCCCCCTCCACG AACAGCGTCCTTTCCACCAGCACAAACCGAAGCAGGAACTCCCCACTTTTGGACA

GGGCCAGCCTTGGCCAGGCCTCCATCCAGAATGGTAAAGACAG CCTAACCATGCCAGGGTCCCGGGCCTCCACGGCTTCTGCTTCTGCCGCAGTCTCTG

CGGCCCGGCCCCGCCAGCACCAGAAATCCATGTCTGCCTCCGTACACCCCAACAAGGCCTCTGGGTTGCCCCCCACGGAGAGTAACTGTGAGGTGCCTCG

GCCCAG CACAGCCCCCCAGCGCGTCCCTGTCGCCTCCCCCTCCGCCCACAACATCAGCAGCAGTAGTGGAGCCCCAGACCGAACTAATTTCCCACGGGG

TGTGTCCAGTCGAAGCACCTTCCATGCTGGGCAGCTCCGACAGGTGCGGGACCAGCAGAATCTACCCTACGGTGTGACCCCAGCCTCTCCCTCTGGCCAT

AGCCAGGGCCGGCGGGGGGCCTCTGGCAGCATCTTCAGCAAGTTCACCTCCAAGTTTGTCCGCAG - UNI29966 - GAACCTGAATGAACCTGAAAG

CAAAGACCGAGTGGAGACGCTCAG - UNI29966 - ACCTCACGTGGTAGGCAGTGGAGGCACTGACAAGGACAAGGAGGAGTTTCGGGAGGCCAAGC

CTCGCTCCCTGCGCTTCACCTGGAGCATGAAGACCACGAGCTCTATGGAGCCCAATGAGATGATGCGGGAGATCCGCAAGGTGCTGGACGCCAACAGCTG

CCAAAGCGAGCTGCACGAGCGGTACATGCTACTGTGCGTGCATGGCACACCAGGCCACGAGAACTTTGTGCAGTGGGAGATGGAGGTGTGCAAACTGCCC

CGGCTGTCTCTCAACGGTGTTCGGTTTAAGCGGATATCGGGCACTTCCATGGCCTTCAAAAACATTGCCTCCAAAATAGCCAATGAGCTGAAGCTTTAAC

AGGCTGTCAGGAGGGGCAGCAGAGGCCCACCAGTGGACTTGGCTGCTTGGGCCAACCCTGCATCCCCCTGGGAGAAACTGCAGGATGAATTGGTGTGTCT

CCCCTGCTGGCACTTGTCCCCTTCCAGGCCCTTCTCAGTTTTTTTCTTCCATGTTTGTGGGGGATGGGAAGTGGTTCTTCTCCCTCCCACATTCACCCCT

GCCCAGAAGTCCCTCCCTTCCCCCCTGCAGGAGGCAAAGGAAGGGGAGGGGGCTGGGGGGGGGCAGGGCTCCCCCTCGGTACTGCGGTTGCACAGAGTAT

TTCGCCTAAACCAAGAAAATTTTTATTACCAAAAAAGAAAAAGAAAAAAAAAAAAATCCCAGCGGCCACCTTTCCTCCCTGCCCCATTGGGACAGTCAAG

ACTGGATCTGTGGGGCTCCTGGGAGGGTGGCTCAGGGCTGGAACACTCTCAGGCAAGAGTGGTGGAGTTCCCTGGCAGGCCCTCCGCCAGGCCCTCTTTG

GGCTTCTCCCCTCTCCCCACTTCTTCCCCCCTTCAAGCGACCCACCAGAGGTGGCCTTCCCCTGCCCCCAAGCCCTTGGGCTTACAGGCCTTTACACTGA

GGCCCAGTTGGGGGTACTGCACAGCCCTGGAGAGGGTGGGCGGTGGGACCCTGGCTCCCTCCACACCATATCCTCTGTCCTTCCCCAGAGCTGGGCACTT

CCTTCCATGAGCTGCTGTGGGGACATGGTTCCCCTTCTCAGAAGTCTGTGCCATCTTCAGGCAGGCTAAACCCAGTACTGGTAGAGGGGAGGGGAATGGG

CCATGGGCTCTCAGCCCCCAGGGGGCAGCTTGGGAACAGGGACACAGCTTCTCCGTTCTGGGAGTCTTTGTCTGAAAGCACAGCCCCTCACCATCCCCCT

ACTGCTTCCCCTTCCTTGGCATTAATCTGGGCACCGTTCTCATCTCACAGCCTTGCCTTTTCTTCCTGGCATTGCCGCCCCTCCTCTCAGGAGACTGTCC

AGGGCCTCCATGGCTGCCTGGCGGAAGGCTGGATTGGGCGGCAGGGCCAGGAGTCTCTTGTCCTCCACAGGGTGGGGCAAAGTAACTCCTGCTTGCTAAC

CTCTGAGGCCAGTGTGTGAATGGGTGGCTGTAGGCGCTTGGCTGGTGGTGGCCACTGCATCCCTTAATTTATTTCTCTGCTGTTTCAGTTCTTGAGAAAT

TGGGGAAGTCCTACAGAGGCTGCCCCTGCCCTCACCTGAGTTGTACATTTTTTTTGTGATGGGTTATTTTTTATTTTTATTATTATTGTTGTTTTGGTTT

TTTTTTTGTTTGTTTTTGATTTATGACAATTCCACTCTTGGCCCCAGTTGTCGTCCTGTCACTCCCTCCCCTGTCCATCACCCTGGCTCCCAGACCAGGC

TCAGCAACACATTGAGTCTTGGGTTCCAGGAACCTTGCCAACCTCAACCCTCCAGCCCGTGCTCCACTGGCTATGGCTCAGACCAAGGGCTCCTCCTCTC

CCCTCTTGCCCTATGGAACAGCCCGGGTGCTCCAAGGGGGCCAGGAGGGCATGGCTTGGCTCCCAAGATAAGGGGTCCGGGGCCAGGACACCCAGGCAAG

GTGGCCCCTCCCTGCCTAGCCCCCTTCCCCCCACCCTGCACTTAGTTTCTCCTCTGGATCAAATACGTAATAAAGAGAATGTTTGGAATCTGA
Translation
MSSARTPLPTLNERDTEQ - UNI3537 - - UNI15882 - PTLGHLDSKPSSKSNMLRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLARHIL

TGKE - UNI15882 - - UNI24312 - VAVKIIDKTQLNSSSLQK - UNI21159 - LFREVRIMKVLNHPNIV - UNI13702 - VKLFEV

IETEKTLYLVMEYASGG - UNI25491 - GEVFDYLVAHGRMKEKEARAKFRQ IVSAVQYCHQKFIVHRDLK AENLLLDADMNIKIADFGFSNEFT

FGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLK - UNI2874 - ELRERVLRGKYRIPFYMSTDCENLLKKFLILN

PSKRGTLE QIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTE ELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGYKSSE LEGDTITLKPRPSADLT

NSSAPSPSHKVQRSVSANPKQRRSSDQA AVPAIPTSNSYSKKTQSNNAENKRPEEETGRKASSTAKVPASPLPGLDRKKTTPAPST NSVLSTSTNRSR

NSPLLDRASLGQASIQNGKDS SLTMPGSRASTASASAAVSAARPRQHQKSMSASVHPNKASGLPPTESNCEVPRPS STAPQRVPVASPSAHNISSSSG

APDRTNFPRGVSSRSTFHAGQLRQVRDQQNLPYGVTPASPSGHSQGRRGASGSIFSKFTSKFVRR - UNI29966 - RNLNEPESKDRVETLR - UN

I29966 - RPHVVGSGGTDKDKEEFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHERYMLLCVHGTPGHENFVQWEMEVCKLPRLS

LNGVRFKRISGTSMAFKNIASKIANELKL

For any suggestions or comments, please send an email to unitrap@crg.es