Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024976 (Shoc2)
Chromosomal location
Chr 19: 54019370 - 54107621 (+)
Description
soc-2 (suppressor of clear) homolog (C. elegans) Gene [Source:MGI Symbol;Acc:MGI:1927197]
RefSeq_dna
NM_019658 
RefSeq_peptide
NP_062632.2 
UniGene
Mm.228669 Mm.418422 
MGI
MGI:1927197 
Uniprot/SWISSPROT
O88520 
Uniprot/SPTREMBL
Q8R378 Q91VH8 
Human Ortholog
ENSG00000108061 (SHOC2)
Omim not available
UniTrap UNI22936
Vector Insertion
Chr 19: 54019504 - 54061943
Public Clones D165H04 (ggtc) IST14510F8 (tigm)
Private Clones OST280812 (lexicon) OST67121 (lexicon) OST59690 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5021
Vector Insertion
Chr 19: 54062874 - 54077498
Public Clones (sanger) YTC450 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5121
Vector Insertion
Chr 19: 54077637 - 54092038
Public Clones YTC340 (baygenomics) YTA350 (baygenomics) CSJ150 (baygenomics) YTC278 (baygenomics)
YTA247 (baygenomics) A054C03 (ggtc) A008F07 (ggtc)
Private Clones OST52067 (lexicon)
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8122
Vector Insertion
Chr 19: 54092170 - 54100839
Public Clones RRG204 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9604
Vector Insertion
Chr 19: 54104469 - 54105557
Public Clones RRB022 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000025932
Sequence
GAGGAGGAGGAAGGAGGTGAGCAGGGATGGTGGAGTCCGGGCTCCGGACGGCAGCCTGGGGCGGGAGCGGCACAGGAGCGCCCGTGGGCCGGTTCTCTGC

TTTCCTGCCTGTCGGGGGGCCCGGCCGGCCGTCG - UNI22936 - GGACTCTAATGAGCTGACCAGGACCATTTTACCAGTTGAAATGAGTTCTCAG

AAATGAGCATAGTGCTGTTAGAGTCACCATGTAACGGACGGATGTGACTCCAAGCGCACCACTTCTTCATGCCAACCCTCTTTGACTGGGAAGGATCTTT

GTCTTTTCATCGTTGATCTGGATTGCTGGCGAGGAGGAGGAGTTCATGTAGTGTTTGAGTGAAGCTTGAGTCACCATGAGTAGTAGTTTAGGAAAAGAAA

AAGACTCTAAAGAGAAAGACCCCAAAGTACCGTCTGCCAAGGAAAGAGAAAAGGAGTCAAAAGCCTCAGGAGGCTTTGGGAAAGAGAGCAAAGAAAAGGA

ACCTAAAGCCAAAGGGAAAGACGCCAAAGATGGAAAGAAGGAGTCCAGCGCTGCCCAGCCAGGTGTGGCTTTTTCAGTCGACAATACCATCAAACGGCCA

AATCCAGCACCCGGCACTAGAAAAAAGTCCAGCAATGCTGAGGTCATTAAGGAGCTTAACAAATGCCGGGAGGAGAACTCAATGCGGTTGGACTTGTCCA

AGAGGTCTATACATATACTGCCACCATCAGTCAAAGAGTTGACTCAACTCACAGAACTTTATTTATACAGTAACAAATTGCAGTCCCTCCCAGCAGAGGT

GGGCTGTCTAGTCAATCTCATGACGCTGGCTCTCAGTGAGAATTCACTCACCAGTTTGCCTGACTCTCTTGATAACTTGAAGAAGCTGCGGATGCTTGAT

TTACGGCATAATAAACTGAGAGAAATTCCTTCAGTGGTGTATAGGCTAGACTCTCTCACCACTCTCTATCTTCGCTTTAATCGCATAACTACTGTGGAAA

AGGACATCAAAAACCTGCCGAAGCTCAGCATGCTCAGCATCCGAGAGAACAAAATCAAGCAGCTGCCTGCTGAAATTG - UNI5021 - GTGAATTAT

GTAACCTCATTACCCTGGATGTAGCTCACAATCAACTTGAACACCTTCCAAAGGAGATTGGAAACTGCACACAGATAACCAACCTTGACTTGCAGCACAA

TGACCTACTGGACCTCCCAGATACAATAG - UNI5121 - GAAACCTGTCCAGTTTAAATCGCCTTGGCCTGAGATACAATAGATTGTCAGCAATACC

CAGATCATTAGCAAAATGCAGTGCACTTGAGGAGTTAAATTTAGAGAACAATAACATTTCTACTCTACCAGAG - UNI8122 - AGTCTTTTATCCAG

TCTTGTAAAATTGAATAGCTTGACCTTAGCTAGAAATTGCTTCCAGTTATATCCAGTGGGAGGTCCATCTCAGTTTTCCACCATTTATTCCCTCAACATG

GAACACAATCGAATCAACAAAATCCCATTTGGAATTTTTTCCAGAGCTAAAGTGTTAAGTAAGCTGAATATGAAG GACAATCAGTTAACATCACTTCCT

TTGGATTTTGGAACTTGGACCAGTATGGTAGAATTGAATTTAGCGACTAATCAGCTCACAAAGATCCCAGAGGATGTGTCTGGTCTCGTTTCCCTTGAG 

GTTCTGATCTTATCGAACAACCTTCTAAAGAAGCTGCCCCACGGCCTTGGGAACCTCAGAAAGCTACGAGAGCTGGACCTGGAGGAGAACAAGCTGGAGT

CCTTGCCCAATGAGATCGCGTATCTCAAGGATCTGCAG AAATTAGTCTTGACAAACAACCAGTTGAGCACGCTTCCCAGAGGCATCGGTCACCTTACCA

ACCTCACGCACCTTGGTCTTGGAGAGAACCTGCTCACTCACCTTCCTGAGGAAATCG - UNI9604 - GTACACTGGAAAACCTAGAAGAACTGTATT

TGAACGACAACCCCAACCTTCACAGCCTCCCCTTTGAGCTTGCTCTCTGCAGCAAGCTGTCAATCATGAGTATTGAGAACTGTCCACTCAGTCACCTCCC

ACCTCAAATTGTTGCTGGAGGGCCTTCGTTCATTATTCAGTTCTTAAAGATGCAGGGTCCATATCGTGCCATGGTCTGATAGAAACTGCTGGTCCCACAC

ACTGTTCAAAAATAGACTGCCATTAATCTTTCATATCTGTATCTGTATCTGTGTGGATATTGATCTATGGCAGATTTATAAAGACTGCATTATGTGTTTC

TGCTAATAGAGGAATCATAGCCATTTAGATTTTTTTAATTCTGTAAAAAAAAAAGGCTTATATAAGTTTTCTTTGCTAAATTTGATGGATGTTTTTCTGT

TGTGTAATCTGATATGCCAGTTTGTTTAAAAATCTTCCAACAAATTATGAAGTCATTAAATTTAAGGGACAAAATAGTATAGTTAAATATATGTTTCTCT

TAGGAAAATGTGGGCCAAAAATTTGTTGCATCTTTTCATATATACATTTCCCCTTAAAATTGTCATATCTTTTAACAGCATAGGCCCTGAAGGTAGAATT

TTTCTTTAACTTATTTTGAAATTTGAAATTTAAATTTTATATATTGTTTACAATCGGAGTGAATCACTGGATTAATTTGATTTGCTCTGTTTTAATCAGT

CAGAGTTTATATTCTTTTAAAGAATTTTCATCAGTTTAAATATTAAAAGATACTTTGTTGAAACAGCTGGCAAACAGAAAATATACATTTAGAAATCAGA

ATTTCCATTAGTTTTATTTCTCCAGTGAACTTTAAAGCAAATATCTGAAGTGAATCTTTGGGGCGGGGGTACTGAAACCTTTCCTAGAATAAGTATGTTT

CACTGTGTGGGAGCAGAAATCTGTGGTGAAAGGTTTTTCTTTTCTTTTCTTTTTATTCCCATTCCTGAAAGTTGCAGATCCACAAAAATTTAACAGAAAT

TTGGCAAGGAAATAAAAAACACATAAACACACATTCTATATATGTATATACAATGCTATATAGATATGTATTTATTATATCATAAACTACAATAGGTAAC

TTTAAAGACTTCTCCCTCCACTTGTACATTGAGATGAATGTCTCTCTAAAGACTGCAGTATATGTGTGTTTCGAGGTTAGGTGACAGTGTACTATGGTTT

TATATCTTGACTCGCCATGTCCATCTGTCTGTTCGGGGGTATCTGTGTCTAAGCACAATATCTTCACACTGTGCTGTATTGCTGCTGAACTAAATGCACT

TTCCCCATCCCCGGGGCACTGGCTTCAAACAATTCAGTTCAGTACTGTTACTTTCAGTCTCGTCACGCCATGGTTAGTGGTGGTAGTACAGATACGGAGA

ACGGCACATGGCATTGATGCCATTGGGAGTTCTGTGGGACTTATGTAGTATGTGCATGGACTCTTTGATAATGTTTTCTTTTGCTTTTCTGCCTTTATGA

ATATCAACTGTAAATGTGTGCCCCTTATGTAGTATTCTTATTTTTGGTAGTGTTTGTCTTAAGTCAGTTTAATTATTGAGAACTCCCCCACCCCCAGAGC

AGGCGCATCCTAGATATAATCTTGAAACACAACTTCCATACAATGAATGACTATTACACATAAGGAAATATTGCTGCTTGTTCTTTTGTGCAAACCCCCC

CCCCCCCATTTTTAAGTATTTTGTCCTAAACAACTGTTTTTAAAAATTAAAACTGTAATATCAAGATAAACATTTGGATTTTTGCTTTTCCTGGCACTCA

AACTCAAGACTGGGTTTGAGGTCAAATCTGTGTTCATAATTGGCAAATTTGTAAGGAACAACTAAGAAATGGAAGGCAGGTAAAGATATAAAACCCTAGA

ATACCTAAATGTGCTGTAAAACTATTGTAGATGTTCACTGGATTTTACAAAGTAATAGCCTTTCTCCTTTTCCATCTACTGTGGCTTTTCAGTTAAGATT

TTGTTTATAAAAGGAATTTATTACAGTTCTACCT
Translation
 - UNI22936 - MSSSLGKEKDSKEKDPKVPSAKEREKESKASGGFGKESKEKEPKAKGKDAKDGKKESSAAQPGVAFSVDNTIKRPNPAPGTRKKSS

NAEVIKELNKCREENSMRLDLSKRSIHILPPSVKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPS

VVYRLDSLTTLYLRFNRITTVEKDIKNLPKLSMLSIRENKIKQLPAEIG - UNI5021 - GELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHND

LLDLPDTIG - UNI5121 - GNLSSLNRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPE - UNI8122 - SLLSSLVKLNSLTLARNCFQL

YPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMK DNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLE VLILSNNLLKKLPHG

LGNLRKLRELDLEENKLESLPNEIAYLKDLQ KLVLTNNQLSTLPRGIGHLTNLTHLGLGENLLTHLPEEIG - UNI9604 - GTLENLEELYLNDNP

NLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLKMQGPYRAMV

For any suggestions or comments, please send an email to unitrap@crg.es