Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025047 (Pdcd11)
Chromosomal location
Chr 19: 47165258 - 47205640 (+)
Description
programmed cell death 11 Gene [Source:MGI Symbol;Acc:MGI:1341788]
RefSeq_dna
NM_011053 
RefSeq_peptide
NP_035183.2 
UniGene
Mm.41166 Mm.449236 
MGI
MGI:1341788 
Uniprot/SPTREMBL
Q9R1Z2 Q9WTU7 Q3TSU4 Q3TUH3 Q3UGG2 Q3URK0 Q6NS46 Q6PIA8 Q6ZQH2 Q7TPE2 Q80XB8 Q9CTD8 
Human Ortholog
ENSG00000148843 (PDCD11)
Omim not available
UniTrap UNI10492
Vector Insertion
Chr 19: 47165358 - 47167271
Public Clones P146E01 (ggtc) P128D12 (ggtc) P134B11 (ggtc) PST22012-NR (escells) PST1138-1 (escells)
PST19647-NR (escells) PST1132-1 (escells)
Private Clones OST417836 (lexicon) OST306679 (lexicon) OST251294 (lexicon) OST245973 (lexicon)
OST114982 (lexicon) OST113546 (lexicon) OST105182 (lexicon) OST81363 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22088
Vector Insertion
Chr 19: 47167391 - 47168240
Public Clones not available
Private Clones OST309047 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3249
Vector Insertion
Chr 19: 47171507 - 47172610
Public Clones AK0417 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10354
Vector Insertion
Chr 19: 47183084 - 47184043
Public Clones XA311 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5292
Vector Insertion
Chr 19: 47185601 - 47186527
Public Clones YTB025 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7816
Vector Insertion
Chr 19: 47191786 - 47191809
Public Clones RRN384 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000079007
Sequence
ACGCCCGG GTCAGCCATCTCTCTGATTCTAAGAAAGCATTCAACG GCCTTCAAACCGGGGAGCACTCACAAGTGTAGAATCATTGACTACAGCCAGAT

GGATGAGCTGGCCTTGCTCTCTCTGCGGAA ATCAATTATTGCAGCTCCATTCCTTAGATATCATGACATCAAAATAGGGACAGTAGTAAAG GGCACAG

TGCTGGCCATAAAGCCATTTGGGATCCTGGTGAAGGTGGGTGAGCAGATAAAAGGCCTGGTGCCCTCCATGCACCTGGCTGACATCATGATGAAGAACCC

AGAGAAGAAGTACAGCCCAGGGGATGAGGTCAAGTGCAGG GTTTTGCTCTGTGACCCTGAAGCCAAGAAGCTAATTATGACCCTGAAAAAAACCCTTGT

CACATCCAAACTGTCTCTCATCACCTGCTATGAGGGTGCCAAGCCTGGCCTGCAGACGCACGGTGTTATCATACGGGTCAAGGACTATGGCTGCATTGTG

AAGTTCTACAACGATGTGCAGGGGCTAGTGCCTAAGCATGAGCTTAGCACCCAGCACATCCCGGACCCAGAGACGGTCTTTTACACTGGCCAG GTGGTA

AAGGTGGCAGTGCTGAGCTGTGAGCCTTCCAAGGAGAGGATGCTCCTGTCCTTCAGACTGTTGAGTGACTCGCGGCCAAAGGATCCGGGTGTTGAGAGCA

GTCAGAAGAAAACAGGAGCTGTGCGCATCGGGCAG TTGGTGGATGTGAAGGTCCTGGAGAAGACCAAAACCGGGCTGGAGGTGGCCATCCTGCCCCATA

ACACCCCTGCTTTCCTCCCCACGCCACACCTGTCCGACCACGCTGCCAATGGCCCACTGTTGCACCACTGGCTCCAGACAGGTGACACCCTTCACCGAGT

TCTGTGTTTGAGCCAGAGTGAGAGACACATT CTTCTTTGCAGGAAACCAGCTTTGGTCTCCACAGTAGAAGGTGGCCAGGACCCCAAGAGCCTCTCAGA

AATCCAGCCCGGAATGTTGCTCATTGGTTTTGTGAAGTGCATCAAGGAGTATGGCGTGTTCGTCCAGTTCCCCTCAGGTCTCAGTGGACTGTCCCCCAAA

ACT - UNI10354 - ATCATGAGTGACAAGTTCGTAACCACTCCAAGTGAACACTTTGTGGAGGGTCAGACAGTCGTTGCTAAGGTGACCAATGTGGA

TGAATCGAAGCAGAGGATGCTGCTGTCTCTGCGGCTGTCAGACTGCAGTCTGGGGGATTCGGCCAGCACCAGCTTCCTCCTCCTGTGCCAGTGCCTGGAA

GAGCTGCAGGGCATTCGCAGCCTCATGAGCAACCAAG ACTCTGTATTGATCCAGACACTTGCTGACATGACCCCGGGGATGGTCCTTGATGCCGTGGTC

CATGAGGTGTTAGAAGATGGTTCAGTGGTGTTCAGTAGTGATCCTGTGCCTGACCTGGTCCTGAGAGCCAGCAGATACCACCGGGCAG - UNI5292 -

 GGCAGGAGGTGGAGCCTGGACAGAAGAAGAAGGTCGTGGTTCTACACGTGGACATGTTGAAGTTGGAGGTCCACGTCTCCCTTCACCAGGACTTGGTGA

ACAGGAAAACGAGAAAG CTGAGAAAAAGCAGTAGACACCAGGGAATCGTACAGCATCTGGAAGAGTCCTTTGCCGTGGCATCCTTGGTGGAGACTGGCC

ACCTTGTGGCTTTCTCTCTGATCTCTCACCTCAATGATACCTTCCACTTTGACTCTGAGAAGCTGCGTGTGGGGCAGGGTGTCTGCCTTACCCTCAAGAC

CACAGAACCGGGAGTGACCGGTCTGATTTTGGCTGTGGAAGGGCCAGCTTCTAAGAGGACCAGGATGCCAGTTCAGAGGGATTCAGAGACAGTTGATGAC

AAAGGAGAGGAGAAAGAGGAGGAGGAGGAGGAGGAGGAGAAGGAAGAAGAGAACTTGACTGTGAAGTCTAAGAAAAGGCATAGCCTGGCTATTGGGGACA

AAGTCACTGGGACCATTAAGGCTGTGAAGGCCACACATGTTGTTGTAACCCTAGCTGATGGCTTTGTTGGCTGTATCCATGCCTCCCGCATCTTAGATGA

TGTCCCAGTGGGCACCTCGCCTACGACCACACTGAAAGCCGGGAAGAAAGTCACTGCGAGAGTGATCGGTGGGCGAGATGTGAAGACATCTAA GTTTCT

CCCAATAAGTCACCCCAGATTTGTTCTGACCATCCTGGAGCTGAGTGTTCGGCCAAG - UNI7816 - TGAGTTGAAGGGTAGCTACAGT
Translation
TPG GSAISLILRKHST AFKPGSTHKCRIIDYSQMDELALLSLRK KSIIAAPFLRYHDIKIGTVVK GTVLAIKPFGILVKVGEQIKGLVPSMHLADI

MMKNPEKKYSPGDEVKCR VLLCDPEAKKLIMTLKKTLVTSKLSLITCYEGAKPGLQTHGVIIRVKDYGCIVKFYNDVQGLVPKHELSTQHIPDPETVFY

TGQ VVKVAVLSCEPSKERMLLSFRLLSDSRPKDPGVESSQKKTGAVRIGQ LVDVKVLEKTKTGLEVAILPHNTPAFLPTPHLSDHAANGPLLHHWLQT

GDTLHRVLCLSQSERHI LLCRKPALVSTVEGGQDPKSLSEIQPGMLLIGFVKCIKEYGVFVQFPSGLSGLSPKT - UNI10354 - IMSDKFVTTPS

EHFVEGQTVVAKVTNVDESKQRMLLSLRLSDCSLGDSASTSFLLLCQCLEELQGIRSLMSNQD DSVLIQTLADMTPGMVLDAVVHEVLEDGSVVFSSDP

VPDLVLRASRYHRAG - UNI5292 - GQEVEPGQKKKVVVLHVDMLKLEVHVSLHQDLVNRKTRK LRKSSRHQGIVQHLEESFAVASLVETGHLVAF

SLISHLNDTFHFDSEKLRVGQGVCLTLKTTEPGVTGLILAVEGPASKRTRMPVQRDSETVDDKGEEKEEEEEEEEKEEENLTVKSKKRHSLAIGDKVTGT

IKAVKATHVVVTLADGFVGCIHASRILDDVPVGTSPTTTLKAGKKVTARVIGGRDVKTSK KFLPISHPRFVLTILELSVRPS - UNI7816 - SELK

GSYS
Transcript ENSMUST00000072141
Sequence
AACGGAAGTAGCCCTGGTCTTACCTACGCTCGTGGACGAGTCGCGTGGAGCTGTCGGCTCCCTGTTCTGCGCGTGCGATTGCGTTGAGACGCTCCGTGAG

 - UNI10492 - CTGCAGAAGACCCCAACATGGCAAACCTGGAGGAAAGCTTCCCCCGAGGGGGGACACGGAAACTCCACAAATCAGAGAAGTCTTCC

CAGCAGGTGGTTGAACAAGACAACTTATTTGAT - UNI22088 - GTTTCCACAGAAGAAGGTCCCATTAAAAGGAAAAAGAGCCAGAAAGGGCCAGC

AAAAACAAAAAAATTGAAAATTGAAAAGAGAAAATCCATCAAATCTATAAAAGAGAAGTTTGAAATTCTTAGTCTTGAG TCCCTATGTGAGGGGATGCG

GATTTTGGGCTGTGTGAAGGAGGTGAGTGAGCTGGAGCTGGTGGTCAGCCTTCCCAACGGCCTCCAAGGGTTTGTGCAAGTGACCGAAGTCTGTGACGCC

TACACTCAGAAGCTGAATGAGCAGGTGGCACAAGAAGAACCTCTGGAG GACCTGCTCCGCCTGCCTGAGCTCTTCTCCCCTGGAATGTTGGTGAGGTGT

GTGGTGAGCAGCCTGGATGTCACAGAGAGTGGCAAGAAGAGCGTCAAGCTTTCTGTGAACCCCAAACGTGTCAACAAAGTGCTGAGTGCTGATGCCCTGA

GGCCTGGCATG - UNI3249 - CTGCTGACAGGCACAGTGTCAAGCCTGGAAGACCATGGCTACCTAGTGGACATTGGCGTTGGTGGGACCAGAGCTT

TTCTGTCACTTAAGAAGGCACAAGAGTACATCCGGCAGAAGAACAAAG GTGCTAAGTTCAAAGTCGGCCAGTACCTGACCTGTGTGGTTGAAGAGGTGA

AAAGCAACGGAGGAGTTGTGAGTCTCTCTGTAGAGCACTCCGAGGTTTCCTCTGCCTTCGCAACTGAGGAGCAAAGCTGGAACCTGAATAACTTACTACC

AGGGCTGCTGGTCAAAGCCCAGGTGCAGAAG GTAACTCAGTTTGGACTCCAGCTAAATTTCCTTACGTTCTTCAAGGGCCTGGTTGACTTCATGCATCT

GGAGCCCAAGAAAATGGGATCTTATTCTTCAAATCAAACG GTAAAAGCCTGCATCCTCTGCGTCCATCCTCGCACCAGAGTTGTGCGACTGAGCCTGCG

CCCCATCTTCCTGCATCCTGGGCGTCCACTCACCCGCATCTCTTACCAGCAGCTAGGGGCTGTGCTAGATGATGTCCCTGTTCAGGGTTTTTTTAAGAAT

GCGGGGGCCATCTTCAGGCTGAAGGATGGGGTACTGGCCTACGCCCGG GTCAGCCATCTCTCTGATTCTAAGAAAGCATTCAACGCTGAGGCCTTCAAA

CCGGGGAGCACTCACAAGTGTAGAATCATTGACTACAGCCAGATGGATGAGCTGGCCTTGCTCTCTCTGCGGAA ATCAATTATTGCAGCTCCATTCCTT

AGATATCATGACATCAAAATAGGGACAGTAGTAAAG GGCACAGTGCTGGCCATAAAGCCATTTGGGATCCTGGTGAAGGTGGGTGAGCAGATAAAAGGC

CTGGTGCCCTCCATGCACCTGGCTGACATCATGATGAAGAACCCAGAGAAGAAGTACAGCCCAGGGGATGAGGTCAAGTGCAGG GTTTTGCTCTGTGAC

CCTGAAGCCAAGAAGCTAATTATGACCCTGAAAAAAACCCTTGTCACATCCAAACTGTCTCTCATCACCTGCTATGAGGGTGCCAAGCCTGGCCTGCAGA

CGCACGGTGTTATCATACGGGTCAAGGACTATGGCTGCATTGTGAAGTTCTACAACGATGTGCAGGGGCTAGTGCCTAAGCATGAGCTTAGCACCCAGCA

CATCCCGGACCCAGAGACGGTCTTTTACACTGGCCAG GTGGTAAAGGTGGCAGTGCTGAGCTGTGAGCCTTCCAAGGAGAGGATGCTCCTGTCCTTCAG

ACTGTTGAGTGACTCGCGGCCAAAGGATCCGGGTGTTGAGAGCAGTCAGAAGAAAACAGGAGCTGTGCGCATCGGGCAG TTGGTGGATGTGAAGGTCCT

GGAGAAGACCAAAACCGGGCTGGAGGTGGCCATCCTGCCCCATAACACCCCTGCTTTCCTCCCCACGCCACACCTGTCCGACCACGCTGCCAATGGCCCA

CTGTTGCACCACTGGCTCCAGACAGGTGACACCCTTCACCGAGTTCTGTGTTTGAGCCAGAGTGAGAGACACATT CTTCTTTGCAGGAAACCAGCTTTG

GTCTCCACAGTAGAAGGTGGCCAGGACCCCAAGAGCCTCTCAGAAATCCAGCCCGGAATGTTGCTCATTGGTTTTGTGAAGTGCATCAAGGAGTATGGCG

TGTTCGTCCAGTTCCCCTCAGGTCTCAGTGGACTGTCCCCCAAAACT - UNI10354 - ATCATGAGTGACAAGTTCGTAACCACTCCAAGTGAACAC

TTTGTGGAGGGTCAGACAGTCGTTGCTAAGGTGACCAATGTGGATGAATCGAAGCAGAGGATGCTGCTGTCTCTGCGGCTGTCAGACTGCAGTCTGGGGG

ATTCGGCCAGCACCAGCTTCCTCCTCCTGTGCCAGTGCCTGGAAGAGCTGCAGGGCATTCGCAGCCTCATGAGCAACCAAG ACTCTGTATTGATCCAGA

CACTTGCTGACATGACCCCGGGGATGGTCCTTGATGCCGTGGTCCATGAGGTGTTAGAAGATGGTTCAGTGGTGTTCAGTAGTGATCCTGTGCCTGACCT

GGTCCTGAGAGCCAGCAGATACCACCGGGCAG - UNI5292 - GGCAGGAGGTGGAGCCTGGACAGAAGAAGAAGGTCGTGGTTCTACACGTGGACAT

GTTGAAGTTGGAGGTCCACGTCTCCCTTCACCAGGACTTGGTGAACAGGAAAACGAGAAAG CTGAGAAAAAGCAGTAGACACCAGGGAATCGTACAGCA

TCTGGAAGAGTCCTTTGCCGTGGCATCCTTGGTGGAGACTGGCCACCTTGTGGCTTTCTCTCTGATCTCTCACCTCAATGATACCTTCCACTTTGACTCT

GAGAAGCTGCGTGTGGGGCAGGGTGTCTGCCTTACCCTCAAGACCACAGAACCGGGAGTGACCGGTCTGATTTTGGCTGTGGAAGGGCCAGCTTCTAAGA

GGACCAGGATGCCAGTTCAGAGGGATTCAGAGACAGTTGATGACAAAGGAGAGGAGAAAGAGGAGGAGGAGGAGGAGGAGGAGAAGGAAGAAGAGAACTT

GACTGTGAAGTCTAAGAAAAGGCATAGCCTGGCTATTGGGGACAAAGTCACTGGGACCATTAAGGCTGTGAAGGCCACACATGTTGTTGTAACCCTAGCT

GATGGCTTTGTTGGCTGTATCCATGCCTCCCGCATCTTAGATGATGTCCCAGTGGGCACCTCGCCTACGACCACACTGAAAGCCGGGAAGAAAGTCACTG

CGAGAGTGATCGGTGGGCGAGATGTGAAGACATCTAA GTTTCTCCCAATAAGTCACCCCAGATTTGTTCTGACCATCCTGGAGCTGAGTGTTCGGCCAA

G - UNI7816 - TGAGTTGAAGGGTAGCTACAGTGCTCTTAATACTCACTCTGAGAGCCCCGTGGAGAAGATCAGGCAGTACCAGGCTGGGCAGACTG

TGACCTGCTTCTTCAAGAAG TACAACGTGATGAAGAAGTGGCTTGAAGTGGACATCGGACCGGACATCCGAGGGAGAATTCCCTTGTTGCTCACTTCCC

TCAGCTTCAAG GTTCTGAAACACCCAGACAAGAAGTTCCAGGTTGGGCAGGCCATCGAGGCCACCGTTGTTGACCCAGACGTCCCCAGGGCTTTCTTAT

GTCTGTCACTCATAG GACCTTACAGACTTGAAGAAGGTGAAGTGGCCATGGGCCGAGTGATGAAGGTTGTACCCAACAGGGGACTGACCGTCTCCTTCC

CTTTTGGGAAGATAGGGAAAGTCAGTATGTTTCACCTGAGCGACTCGTACTCCGAGGCACCCCTGGAGGACTTCTGCCCCCAGAAGATTGTCAG ATGTT

ACATCCTGTCCACAGCACACCGTGTGCTGGCTTTGTCACTCCGGTCATCCAG GACAAACAGAGAGACAAAAAACAGAATAGAAGATCCAGAAATCAACT

CCATTGAGGACGTGAAGGAAGGGCAGCTCCTGCGGGGCTATGTGAAATGTGTCCTGCCAAGCAGTGTGATCATAGG CCTTGGACCTTCAGTTCTGGGTT

TGGCCAAGTATTCACATGTCTCTGAGTGTGTCCCACCAGAGAAAGAGCTTTATAACGGATGCCTCCCTGAGGGAAAGCTGGTCACTGCCAAGGTCCTGCG

 CGTGAACCCCATGAAGAACCTGATAGAGCTGTCGCTCCTTCCCAGCGACACTGGGAGGCCAGACGTGTTCTCTCCTGCTCCAGAACCAAAACAAGAGGA

GAGGAGCGGAGGGGCTGAGGAGGGCCAGAAAAGGAAAGAGAAGAACCAGAAGAGACGGGAGGAGAAGGAAGAGCCCCAGAAGTCACAGAGGGGTGGGCGA

GGCAAGCGGGAGCGCCAGGAGTCTGAGAGCGAGCAG GAACTAGTGAACAAGAGGCCAAAGAAGTCTGGAGCCGCAGAAGAAGACGACAGTGGTGTGGAA

GTGTACTACCGGGAAGGAGAGGATGAGGTGGGGGAGCCGAAGCTGCCACCCAGG GGGAAGCAGACAAAATCCACAGAGGTGCCCCGGCTGCATCTCTCT

TCAGGCTTCCTTTGGGATGTGGGGCTTGACTCTCTGACTCCAGCCTTGCCACTCCGAGAAGAGAGCTCAGACAGCGAGGATGAGCAGCCGCACCAAGCTA

AG AAGAAGAAGGGCAAGAAGGAGAGGGAGCTGGAGAAGCAGAAGGCAGAGAAGGAGCTGTCGCGCATTGAGGAGGCACTCATGGACCCTGGGCGACAGC

CAGAGTCTGCGGATGACTTTGACCGGCTGGTGCTAAGCTCTCCCAACAGCTCCATCCTTTGGCTGCAGTACATGGCTTTCCACCTACAGGCCACGGAGAT

CGAGAAGGCCCGGGCTGTGGCTGAGAGGGCCCTGAAGACCATCTCATTCAG AGAGGAGCAGGAGAAGCTGAACGTGTGGGTGGCCCTGCTGAACCTGGA

AAACATGTACGGCTCTCAGGAGTCCCTGACTAAGGTCTTCGAGCGAGCTGTGCAGTACAACGAGCCTCTCAAGGTTTTCCTGCATCTGGCTGACATCTAC

ACCAAGTCCGAGAAATACAAG GAAGCTGGTGAGCTGTACAACCGGATGCTGAAACGGTTCCGGCAGGAGAAGGCTGTCTGGATCAAATATGGTGCCTTT

GTTTTGGGGAGGAGTCAGGCTGGGGCCAGTCACCGAGTGCTGCAGCGAGCCCTGGAGTGCCTGCCCGCCAAGGAAC ATGTGGATGTGATCGTCAAGTTT

GCCCAGCTGGAGTTCCAGCTCGGGGACGTGGAGCGCGCTAAAGCCATTTTTGAAAACACACTGAGCACCTACCCCAAACGCACAGACGTCTGGTCAGTCT

ACATCGACATGACCATCAAGCACGGCAGCCAGACAGCAGTCAG GGACATCTTTGAGCGGGTCATTCACCTGAGCCTGGCGCCTAAGAGGATGAAGTTCT

TTTTCAAGCGCTACCTGGACTATGAGAAGCAGCACGGCACGGAGAAGGACGTGCAGGCGGTCAAGGCCAAGGCCTTGGAGTATGTGGAGGCCAAGAGCTC

GGCGCTGGAGGACTAGGAGCACAGGCTCCGCCGGACGGACAGACAGCGGAGGCAGCAGGCAGCCTAACCCATAGCCGGGCGGGTGCTGGGGCTGTCCCAG

GACTGCTTTAGTTGCTGTTGTTTCTGCAGCATGCCTGTGGGCTGTGGTGCTCACAGAAGGCAGACTTGGCTCACTAAGGCTGAGTTCCTCATCTTGTCAG

AGTAAAAAAAAACTGTCAAAAGATTGTTTTAAAATCTTTTGAGACAGGGTTTGTATTATGGTCTTGGCTGGCCTGGAACCTGCTATGTAGACTCAGCCAG

CCTTGAACTTAGAAGGGATTAAAGGCACATACGATCACTTTTTACTTTTAAATGTG
Translation
 - UNI10492 - MANLEESFPRGGTRKLHKSEKSSQQVVEQDNLFD - UNI22088 - VSTEEGPIKRKKSQKGPAKTKKLKIEKRKSIKSIKEKF

EILSLE SLCEGMRILGCVKEVSELELVVSLPNGLQGFVQVTEVCDAYTQKLNEQVAQEEPLE DLLRLPELFSPGMLVRCVVSSLDVTESGKKSVKLSV

NPKRVNKVLSADALRPGM - UNI3249 - LLTGTVSSLEDHGYLVDIGVGGTRAFLSLKKAQEYIRQKNKG GAKFKVGQYLTCVVEEVKSNGGVVSL

SVEHSEVSSAFATEEQSWNLNNLLPGLLVKAQVQK VTQFGLQLNFLTFFKGLVDFMHLEPKKMGSYSSNQT VKACILCVHPRTRVVRLSLRPIFLHPG

RPLTRISYQQLGAVLDDVPVQGFFKNAGAIFRLKDGVLAYAR VSHLSDSKKAFNAEAFKPGSTHKCRIIDYSQMDELALLSLRK KSIIAAPFLRYHDI

KIGTVVK GTVLAIKPFGILVKVGEQIKGLVPSMHLADIMMKNPEKKYSPGDEVKCR VLLCDPEAKKLIMTLKKTLVTSKLSLITCYEGAKPGLQTHGV

IIRVKDYGCIVKFYNDVQGLVPKHELSTQHIPDPETVFYTGQ VVKVAVLSCEPSKERMLLSFRLLSDSRPKDPGVESSQKKTGAVRIGQ LVDVKVLEK

TKTGLEVAILPHNTPAFLPTPHLSDHAANGPLLHHWLQTGDTLHRVLCLSQSERHI LLCRKPALVSTVEGGQDPKSLSEIQPGMLLIGFVKCIKEYGVF

VQFPSGLSGLSPKT - UNI10354 - IMSDKFVTTPSEHFVEGQTVVAKVTNVDESKQRMLLSLRLSDCSLGDSASTSFLLLCQCLEELQGIRSLMSN

QD DSVLIQTLADMTPGMVLDAVVHEVLEDGSVVFSSDPVPDLVLRASRYHRAG - UNI5292 - GQEVEPGQKKKVVVLHVDMLKLEVHVSLHQDLV

NRKTRK LRKSSRHQGIVQHLEESFAVASLVETGHLVAFSLISHLNDTFHFDSEKLRVGQGVCLTLKTTEPGVTGLILAVEGPASKRTRMPVQRDSETVD

DKGEEKEEEEEEEEKEEENLTVKSKKRHSLAIGDKVTGTIKAVKATHVVVTLADGFVGCIHASRILDDVPVGTSPTTTLKAGKKVTARVIGGRDVKTSK 

KFLPISHPRFVLTILELSVRPS - UNI7816 - SELKGSYSALNTHSESPVEKIRQYQAGQTVTCFFKK YNVMKKWLEVDIGPDIRGRIPLLLTSLS

FK VLKHPDKKFQVGQAIEATVVDPDVPRAFLCLSLIG GPYRLEEGEVAMGRVMKVVPNRGLTVSFPFGKIGKVSMFHLSDSYSEAPLEDFCPQKIVR 

RCYILSTAHRVLALSLRSSR RTNRETKNRIEDPEINSIEDVKEGQLLRGYVKCVLPSSVIIG GLGPSVLGLAKYSHVSECVPPEKELYNGCLPEGKLV

TAKVLR RVNPMKNLIELSLLPSDTGRPDVFSPAPEPKQEERSGGAEEGQKRKEKNQKRREEKEEPQKSQRGGRGKRERQESESEQ ELVNKRPKKSGAA

EEDDSGVEVYYREGEDEVGEPKLPPR GKQTKSTEVPRLHLSSGFLWDVGLDSLTPALPLREESSDSEDEQPHQAK KKKGKKERELEKQKAEKELSRIE

EALMDPGRQPESADDFDRLVLSSPNSSILWLQYMAFHLQATEIEKARAVAERALKTISFR REEQEKLNVWVALLNLENMYGSQESLTKVFERAVQYNEP

LKVFLHLADIYTKSEKYK EAGELYNRMLKRFRQEKAVWIKYGAFVLGRSQAGASHRVLQRALECLPAKEH HVDVIVKFAQLEFQLGDVERAKAIFENT

LSTYPKRTDVWSVYIDMTIKHGSQTAVR RDIFERVIHLSLAPKRMKFFFKRYLDYEKQHGTEKDVQAVKAKALEYVEAKSSALED

For any suggestions or comments, please send an email to unitrap@crg.es