Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025083 (Afap1l2)
Chromosomal location
Chr 19: 56986850 - 57082718 (-)
Description
actin filament associated protein 1-like 2 Gene [Source:MGI (curated);Acc:Afap1l2-001]
Human Ortholog
not available
Omim not available
UniTrap UNI36646
Vector Insertion
Chr 19: 57039286 - 57076794
Public Clones IST10914E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000122359
Sequence
AGCGCGGAGTCCAGCGCGGAGAACTCAGCGCGGAGCCGATAGCAGCGCACACCGTGCCCGGGATGGAGCGCTACAAAG - UNI36646 - TTCAGAAT

AGCCACATCTCATGTACTTAATCATTACATGTGGCAAGATGTATCTCCGCCTTAG - UNI36646 - GCAAAGACAAATGTGGAGATAAATTCCTCCC

AGAAGTAATGAG CCCTGGAGCAGCTGCTGACAGAGCTGGACGACTTCCTTAAGGTCCTCGACCAGGAGAACCTGAGCAGTGCAGCCGTGCTGAAGAAGA

GCGGCCTGTCAGAGCTCCTGCGGCTTTACACCAAGAGCAGCA GTTCTGATGAGGAGTATATTTACATGAACAAAGTGTCAGTCAACGGGGAACAAAACT

CAGCATCTCCAGACAAAG TTCCCGAGGAGCAGGGTCCACTGACCAATGGGGAGCCCAGCCAGCATTCCTCAGCCCCTCAGAAGAGCCTTCCAGACCTCC

CTCCGCCCAAGATG ATTCCAGAGAGGAAACAGCCCACCGTTCCAAAGATCGAGTCCCCTGAGGGCTACTATGAAGAGGCTGAGCCATTTGACAGATCCA

TCAATG AGGATGGAGAGGCTGTGAGCAGCTCCTACGAGTCCTACGATGAGGACGAGAACAGCAAAGGCAAGGCTGCCCCCTACCAGTGGCCCTCGCCCG

AGGCCAGCATTGAGCTGATGCGTGATGCCCGCATCTGTGCCTTCCTGTGGCGCAAGAAGTGGCTAGGCCAGTGGGCCAAGCAGCTCTGTGTGATCAGGGA

CACCAGGCTCTTG TGCTACAAATCGTCCAAAGACCACAGTCCTCAGCTGGACGTGAACCTGCGGGGCAGCAGCGTCGTGCACAAGGAGAAGCAAGTGCG

GAAGAAAGGACACAAGCTCAAGATCACACCGATGAACGCTGACGTTATCGTGCTGGGCCTGCAGAGCAAGGACCAAGCTGAGCAGTGGCTTCGG GTCAT

CCAGGAGGTGAGTGGCCTGCCTTCTGAAGGAGCCTCAGAGGGAAACCAGTACACACCAGATGCCCAGCGCCTCAACTGTCAGAAA CCAGACATAGCTGA

GAAGTACCTGTCAGCAGCGGAGTACGGGATCACCATCAACGGCCACCCTGAGATCCCAGAGACCAAAGATG TCAAGAAGAAATGCTCTGCTGGCCTCAA

GCTGAGCAACCTTATGAACCTGGGCAGGAAGAAATCTACCTCGCTGGAGCCCCCGGAGAGATCCCTTGAGACATCCA GCTACCTGAATGTGCTGGTGAA

CAGTCAATGGAAGTCACGCTGGTGCTTCGTTAGAGACAGCCACCTGCACTTCTACCAGGACCGGAACCGGAGCAAGGTGGCCCAGCAGCCCCTCAGCCTG

GTGGGCTGTGACGTGCTTCCAGATCCTAGCCCCGACCACCTGTATTCCTTCCGTATTCTCCACAACGGCGAGGAGCTAGCCAAGCTTGAG GCCAAGTCT

TCAGAGGAGATGGGCCACTGGCTAGGCCTCCTGCTCTCAGAGTCGGGCTCCAAGACTGACCCGGAAGAGCTCACCTACGACTATGTGGATGCTGAAAGGG

TTTCCTGTATTGTGAGTGCGGCCAAAACCTCTCTCTT ACTGATGCAGAGAAAGTTCTCAGAGCCCAACACATACATCGATGGCCTGCCCAGCCGGGATT

GCCAGGACGATCTGTATGATGATGTGGAGGTATCAGAGCTGATAGCCGTG GTGGAGCCTGCCGAGGAAGCCGCCCCTGCTGTCGATGCTAACAGTGGTA

GTGAGCCAGACAGAGTCTACCTGGATCTCACACCGGTCAAGTCCTTCCTGCACAGTAGCAGTGAGGCTCAGGCGCAGGCCTCTCTCCCAGCAGTGCCACA

TCAGGACGATGTAGCTGAGACCCTCACAGTAGACCCAAAGCCAGGCACCACCCCAGAGGAGCCCCACACAGAGTCTCCAGGAGACCCAGAGGTGCAGCAG

 AGGCAACCAGAGGTTCAAGAGTCTTCAGAGCCTATCGAGCCCACCCCGCGAATCACCATGGTTAAGCTACAGGCCGAGCAGCAGAGAATCTCCTTCCCA

GCCAACTGCCCAGACACCATGGCTTCTGCCCCCATCGCTGCCAGCCCACCTGTGAAGGAGAAGCTGAGAGTGACCAGTGCAG AGATCAAACTTGGGAAG

AATCGGACAGAGGCGGAAGTAAAGCGGTACACGGAGGAGAAGGAGAGGCTGGAGAGGAGCAAGGAGGAGATCCGAGGGCACCTGGCTCAGCTCCGCAGAG

AGAAGCGGGAGCTCAAAGAGACCCTGTTGAGATGCACAG ATAAGGGGGTCCTGGCCAAGCTGGAGCAGACACTGAAGAAAATAGACGAGGAATGCCGGA

TGGAGGAGAGCAGGCGTGTGGACCTTGAGCTCAGCATCATGGAGGTGAAGGACAACCTGAAGAAGGCAGAGGCTGGGCCCGTGACCCTGGGCACCACTGT

GGATACCACGCACCTGGACAACATGAGCCCTCGT CCACAGCCCAAAGCTGCCACCCCCAACCCCCCACCAGACTCCACGCCAGTCAACTCTGCATCTGT

GCTCAAGAACAGGCCTCTTTCCGTCATGGTCACAGGCAAAGGCACTGTCCTGCAGAAAGCCAAG GAATGGGAGAAGAAAGGAGCCAGTTAGGAGACAAG

AATTGCCTAAAGACTCTTATGTGACTGTGGACCTTGGTGACAATCCTGCTCTGGACAAGTCTTCAATAAAACAGCAACTCTGAGGAAAGGTGAGTCTGTT

TACAAGACAAAGCAAGGGATGAGGCGCTCGCTGCAAACGGAGCTTCGGTTAAGAGAAGGCCCTGTCTCCTCCTCAAGCCAAAGGGATCCCAGCAGCAGCA

TCGTGGTGGCATCTTTGGAGTCGAAATCTACTGGCTGTCAATGAGACAATGTACCTTCCCTTTTCTTTTTAAAGATTTCATCCATCACTCAACTGTTTTA

CCAAGATTTTTCAGGTGTGAAAAAATGACCACATTGCTTCTGGTTATGAGAAAAATCTAAATTCCTGACCCCCTTATCTTTCATCCTGTATTTGGCAATG

TTGAGGTTTAAATCATGCATTGTCTTCATGTTTGCCCAAATTGGGTGGGCTCCATGTGGTCTCTGATGGTCTTAAAGAACATTAGAACCCTGTAATCAGT

AGAAGAGGGACATATTGGGAACCAAGCCAAGGCACTGACCCCCTTGGGGTCACTAAGGACTTCCCCCCAGTCCAGGAAAACTTTAAACAATGCTGTATTA

TATAGGGGGAAAATTCCTGTGTTTACAGACTGTCCTGTGGCCAGGCCACTTTTAAGAGTTGGTCAATTACCTCTTCATTACCATTGTAAAGATGTTTTAA

ATTTCTGGTCCCCTTGCAAGGAAAACAGCCGTGAATTAGCCTGTCTAGTCTGTCAGACTGGCAGCCAGTGCTGTCTTTATGTGCTGTCTCTCTGGGACAG

CACTAGCACAAGTTGATACATTTCATCTGTTACCTGCCCCATTTCTGAGCATTTGGAACTAGTTACCTAACACTGGTTTCTGAAGGCTAAATGTTTTTAC

GCATATATTATTGTCTTTCTAATCCCAGGGCATTTATTTCCTGTATCATAAACACTTGGTGACCTTTATCAAGTGGTGAGTTAGAATTTTTTTTTTAAAT

AAAATGTTCATTG
Translation
 - UNI36646 -  - UNI36646 -   MNKVSVNGEQNSASPDKV VPEEQGPLTNGEPSQHSSAPQKSLPDLPPPKM IPERKQPTVPKIESPEGY

YEEAEPFDRSINE EDGEAVSSSYESYDEDENSKGKAAPYQWPSPEASIELMRDARICAFLWRKKWLGQWAKQLCVIRDTRLL CYKSSKDHSPQLDVNL

RGSSVVHKEKQVRKKGHKLKITPMNADVIVLGLQSKDQAEQWLR VIQEVSGLPSEGASEGNQYTPDAQRLNCQK PDIAEKYLSAAEYGITINGHPEIP

ETKDV VKKKCSAGLKLSNLMNLGRKKSTSLEPPERSLETSS SYLNVLVNSQWKSRWCFVRDSHLHFYQDRNRSKVAQQPLSLVGCDVLPDPSPDHLYS

FRILHNGEELAKLE AKSSEEMGHWLGLLLSESGSKTDPEELTYDYVDAERVSCIVSAAKTSLL LLMQRKFSEPNTYIDGLPSRDCQDDLYDDVEVSEL

IAV VEPAEEAAPAVDANSGSEPDRVYLDLTPVKSFLHSSSEAQAQASLPAVPHQDDVAETLTVDPKPGTTPEEPHTESPGDPEVQQ RQPEVQESSEPI

EPTPRITMVKLQAEQQRISFPANCPDTMASAPIAASPPVKEKLRVTSAE EIKLGKNRTEAEVKRYTEEKERLERSKEEIRGHLAQLRREKRELKETLLR

CTD DKGVLAKLEQTLKKIDEECRMEESRRVDLELSIMEVKDNLKKAEAGPVTLGTTVDTTHLDNMSPR PQPKAATPNPPPDSTPVNSASVLKNRPLSV

MVTGKGTVLQKAK EWEKKGAS
Transcript ENSMUST00000086814
Sequence
GAGAACTCAGCGCGGAGCCGATAGCAGCGCACACCGTGCCCGGGATGGAGCGCTACAAAG - UNI36646 - CACAGGGCTGTTGCTGTCTGGTGGTG

CAGAGAAGAATCCTGCAGGTCTCTGCTT - UNI36646 - CCCTGGAGCAGCTGCTGACAGAGCTGGACGACTTCCTTAAGGTCCTCGACCAGGAGAA

CCTGAGCAGTGCAGCCGTGCTGAAGAAGAGCGGCCTGTCAGAGCTCCTGCGGCTTTACACCAAGAGCAGCA GTTCTGATGAGGAGTATATTTACATGAA

CAAAGTGTCAGTCAACGGGGAACAAAACTCAGCATCTCCAGACAAAG TTCCCGAGGAGCAGGGTCCACTGACCAATGGGGAGCCCAGCCAGCATTCCTC

AGCCCCTCAGAAGAGCCTTCCAGACCTCCCTCCGCCCAAGATG ATTCCAGAGAGGAAACAGCCCACCGTTCCAAAGATCGAGTCCCCTGAGGGCTACTA

TGAAGAGGCTGAGCCATTTGACAGATCCATCAATG AGGATGGAGAGGCTGTGAGCAGCTCCTACGAGTCCTACGATGAGGACGAGAACAGCAAAGGCAA

GGCTGCCCCCTACCAGTGGCCCTCGCCCGAGGCCAGCATTGAGCTGATGCGTGATGCCCGCATCTGTGCCTTCCTGTGGCGCAAGAAGTGGCTAGGCCAG

TGGGCCAAGCAGCTCTGTGTGATCAGGGACACCAGGCTCTTG TGCTACAAATCGTCCAAAGACCACAGTCCTCAGCTGGACGTGAACCTGCGGGGCAGC

AGCGTCGTGCACAAGGAGAAGCAAGTGCGGAAGAAAGGACACAAGCTCAAGATCACACCGATGAACGCTGACGTTATCGTGCTGGGCCTGCAGAGCAAGG

ACCAAGCTGAGCAGTGGCTTCGG GTCATCCAGGAGGTGAGTGGCCTGCCTTCTGAAGGAGCCTCAGAGGGAAACCAGTACACACCAGATGCCCAGCGCC

TCAACTGTCAGAAA CCAGACATAGCTGAGAAGTACCTGTCAGCAGCGGAGTACGGGATCACCATCAACGGCCACCCTGAGATCCCAGAGACCAAAGATG

 TCAAGAAGAAATGCTCTGCTGGCCTCAAGCTGAGCAACCTTATGAACCTGGGCAGGAAGAAATCTACCTCGCTGGAGCCCCCGGAGAGATCCCTTGAGA

CATCCA GCTACCTGAATGTGCTGGTGAACAGTCAATGGAAGTCACGCTGGTGCTTCGTTAGAGACAGCCACCTGCACTTCTACCAGGACCGGAACCGGA

GCAAGGTGGCCCAGCAGCCCCTCAGCCTGGTGGGCTGTGACGTGCTTCCAGATCCTAGCCCCGACCACCTGTATTCCTTCCGTATTCTCCACAACGGCGA

GGAGCTAGCCAAGCTTGAG GCCAAGTCTTCAGAGGAGATGGGCCACTGGCTAGGCCTCCTGCTCTCAGAGTCGGGCTCCAAGACTGACCCGGAAGAGCT

CACCTACGACTATGTGGATGCTGAAAGGGTTTCCTGTATTGTGAGTGCGGCCAAAACCTCTCTCTT ACTGATGCAGAGAAAGTTCTCAGAGCCCAACAC

ATACATCGATGGCCTGCCCAGCCGGGATTGCCAGGACGATCTGTATGATGATGTGGAGGTATCAGAGCTGATAGCCGTG GTGGAGCCTGCCGAGGAAGC

CGCCCCTGCTGTCGATGCTAACAGTGGTAGTGAGCCAGACAGAGTCTACCTGGATCTCACACCGGTCAAGTCCTTCCTGCACAGTAGCAGTGAGGCTCAG

GCGCAGGCCTCTCTCCCAGCAGTGCCACATCAGGACGATGTAGCTGAGACCCTCACAGTAGACCCAAAGCCAGGCACCACCCCAGAGGAGCCCCACACAG

AGTCTCCAGGAGACCCAGAGGTGCAGCAG AGGCAACCAGAGGTTCAAGAGTCTTCAGAGCCTATCGAGCCCACCCCGCGAATCACCATGGTTAAGCTAC

AGGCCGAGCAGCAGAGAATCTCCTTCCCAGCCAACTGCCCAGACACCATGGCTTCTGCCCCCATCGCTGCCAGCCCACCTGTGAAGGAGAAGCTGAGAGT

GACCAGTGCAG AGATCAAACTTGGGAAGAATCGGACAGAGGCGGAAGTAAAGCGGTACACGGAGGAGAAGGAGAGGCTGGAGAGGAGCAAGGAGGAGAT

CCGAGGGCACCTGGCTCAGCTCCGCAGAGAGAAGCGGGAGCTCAAAGAGACCCTGTTGAGATGCACAG ATAAGGGGGTCCTGGCCAAGCTGGAGCAGAC

ACTGAAGAAAATAGACGAGGAATGCCGGATGGAGGAGAGCAGGCGTGTGGACCTTGAGCTCAGCATCATGGAGGTGAAGGACAACCTGAAGAAGGCAGAG

GCTGGGCCCGTGACCCTGGGCACCACTGTGGATACCACGCACCTGGACAACATGAGCCCTCGT CCACAGCCCAAAGCTGCCACCCCCAACCCCCCACCA

GACTCCACGCCAGTCAACTCTGCATCTGTGCTCAAGAACAGGCCTCTTTCCGTCATGGTCACAGGCAAAGGCACTGTCCTGCAGAAAGCCAAG GAATGG

GAGAAGAAAGGAGCCAGTTAGGAGACAAGAATTGCCTAAAGACTCTTATGTGACTGTGGACCTTGGTGACAATCCTGCTCTGGACAAGTCTTCAATAAAA

CAGCAACTCTGAGGAAAGGTGAGTCTGTTTACAAGACAAAGCAAGGGATGAGGCGCTCGCTGCAAACGGAGCTTCGGTTAAGAGAAGGCCCTGTCTCCTC

CTCAAGCCAAAGGGATCCCAGCAGCAGCATCGTGGTGGCATCTTTGGAGTCGAAATCTACTGGCTGTCAATGAGACAATGTACCTTCCCTTTTCTTTTTA

AAGATTTCATCCATCACTCAACTGTTTTACCAAGATTTTTCAGGTGTGAAAAAATGACCACATTGCTTCTGGTTATGAGAAAAATCTAAATTCCTGACCC

CCTTATCTTTCATCCTGTATTTGGCAATGTTGAGGTTTAAATCATGCATTGTCTTCATGTTTGCCCAAATTGGGTGGGCTCCATGTGGTCTCTGATGGTC

TTAAAGAACATTAGAACCCTGTAATCAGTAGAAGAGGGACATATTGGGAACCAAGCCAAGGCACTGACCCCCTTGGGGTCACTAAGGACTTCCCCCCAGT

CCAGGAAAACTTTAAACAATGCTGTATTATATAGGGGGAAAATTCCTGTGTTTACAGACTGTCCTGTGGCCAGGCCACTTTTAAGAGTTGGTCAATTACC

TCTTCATTACCATTGTAAAGATGTTTTAAATTTCTGGTCCCCTTGCAAGGAAAACAGCCGTGAATTAGCCTGTCTAGTCTGTCAGACTGGCAGCCAGTGC

TGTCTTTATGTGCTGTCTCTCTGGGACAGCACTAGCACAAGTTGATACATTTCATCTGTTACCTGCCCCATTTCTGAGCATTTGGAACTAGTTACCTAAC

ACTGGTTTCTGAAGGCTAAATGTTTTTACGCATATATTATTGTCTTTCTAATCCCAGGGCATTTATTTCCTGTATCATAAACACTTGGTGACCTTTATCA

AGTGGTGAGTTAGAATTTTTTTTTTAAATAAAATGTTCATTGT
Translation
 - UNI36646 -  - UNI36646 -  MNKVSVNGEQNSASPDKV VPEEQGPLTNGEPSQHSSAPQKSLPDLPPPKM IPERKQPTVPKIESPEGYY

EEAEPFDRSINE EDGEAVSSSYESYDEDENSKGKAAPYQWPSPEASIELMRDARICAFLWRKKWLGQWAKQLCVIRDTRLL CYKSSKDHSPQLDVNLR

GSSVVHKEKQVRKKGHKLKITPMNADVIVLGLQSKDQAEQWLR VIQEVSGLPSEGASEGNQYTPDAQRLNCQK PDIAEKYLSAAEYGITINGHPEIPE

TKDV VKKKCSAGLKLSNLMNLGRKKSTSLEPPERSLETSS SYLNVLVNSQWKSRWCFVRDSHLHFYQDRNRSKVAQQPLSLVGCDVLPDPSPDHLYSF

RILHNGEELAKLE AKSSEEMGHWLGLLLSESGSKTDPEELTYDYVDAERVSCIVSAAKTSLL LLMQRKFSEPNTYIDGLPSRDCQDDLYDDVEVSELI

AV VEPAEEAAPAVDANSGSEPDRVYLDLTPVKSFLHSSSEAQAQASLPAVPHQDDVAETLTVDPKPGTTPEEPHTESPGDPEVQQ RQPEVQESSEPIE

PTPRITMVKLQAEQQRISFPANCPDTMASAPIAASPPVKEKLRVTSAE EIKLGKNRTEAEVKRYTEEKERLERSKEEIRGHLAQLRREKRELKETLLRC

TD DKGVLAKLEQTLKKIDEECRMEESRRVDLELSIMEVKDNLKKAEAGPVTLGTTVDTTHLDNMSPR PQPKAATPNPPPDSTPVNSASVLKNRPLSVM

VTGKGTVLQKAK EWEKKGAS
Transcript ENSMUST00000111583
Sequence
AACTGCTACAAAG CCCTGGAGCAGCTGCTGACAGAGCTGGACGACTTCCTTAAGGTCCTCGACCAGGAGAACCTGAGCAGTGCAGCCGTGCTGAAGAAG

AGCGGCCTGTCAGAGCTCCTGCGGCTTTACACCAAGAGCAGCA GTTCTGATGAGGAGTATATTTACATGAACAAAGTGTCAGTCAACGGGGAACAAAAC

TCAGCATCTCCAGACAAAG TTCCCGAGGAGCAGGGTCCACTGACCAATGGGGAGCCCAGCCAGCATTCCTCAGCCCCTCAGAAGAGCCTTCCAGACCTC

CCTCCGCCCAAGATG ATTCCAGAGAGGAAACAGCCCACCGTTCCAAAGATCGAGTCCCCTGAGGGCTACTATGAAGAGGCTGAGCCATTTGACAGATCC

ATCAATG AGGATGGAGAGGCTGTGAGCAGCTCCTACGAGTCCTACGATGAGGACGAGAACAGCAAAGGCAAGGCTGCCCCCTACCAGTGGCCCTCGCCC

GAGGCCAGCATTGAGCTGATGCGTGATGCCCGCATCTGTGCCTTCCTGTGGCGCAAGAAGTGGCTAGGCCAGTGGGCCAAGCAGCTCTGTGTGATCAGGG

ACACCAGGCTCTTG TGCTACAAATCGTCCAAAGACCACAGTCCTCAGCTGGACGTGAACCTGCGGGGCAGCAGCGTCGTGCACAAGGAGAAGCAAGTGC

GGAAGAAAGGACACAAGCTCAAGATCACACCGATGAACGCTGACGTTATCGTGCTGGGCCTGCAGAGCAAGGACCAAGCTGAGCAGTGGCTTCGG GTCA

TCCAGGAGGTGAGTGGCCTGCCTTCTGAAGGAGCCTCAGAGGGAAACCAGTACACACCAGATGCCCAGCGCCTCAACTGTCAGAAA CCAGACATAGCTG

AGAAGTACCTGTCAGCAGCGGAGTACGGGATCACCATCAACGGCCACCCTGAGATCCCAGAGACCAAAGATG TCAAGAAGAAATGCTCTGCTGGCCTCA

AGCTGAGCAACCTTATGAACCTGGGCAGGAAGAAATCTACCTCGCTGGAGCCCCCGGAGAGATCCCTTGAGACATCCA GCTACCTGAATGTGCTGGTGA

ACAGTCAATGGAAGTCACGCTGGTGCTTCGTTAGAGACAGCCACCTGCACTTCTACCAGGACCGGAACCGGAGCAAGGTGGCCCAGCAGCCCCTCAGCCT

GGTGGGCTGTGACGTGCTTCCAGATCCTAGCCCCGACCACCTGTATTCCTTCCGTATTCTCCACAACGGCGAGGAGCTAGCCAAGCTTGAG GCCAAGTC

TTCAGAGGAGATGGGCCACTGGCTAGGCCTCCTGCTCTCAGAGTCGGGCTCCAAGACTGACCCGGAAGAGCTCACCTACGACTATGTGGATGCTGAAAGG

GTTTCCTGTATTGTGAGTGCGGCCAAAACCTCTCTCTT ACTGATGCAGAGAAAGTTCTCAGAGCCCAACACATACATCGATGGCCTGCCCAGCCGGGAT

TGCCAGGACGATCTGTATGATGATGTGGAGGTATCAGAGCTGATAGCCGTG GTGGAGCCTGCCGAGGAAGCCGCCCCTGCTGTCGATGCTAACAGTGGT

AGTGAGCCAGACAGAGTCTACCTGGATCTCACACCGGTCAAGTCCTTCCTGCACAGTAGCAGTGAGGCTCAGGCGCAGGCCTCTCTCCCAGCAGTGCCAC

ATCAGGACGATGTAGCTGAGACCCTCACAGTAGACCCAAAGCCAGGCACCACCCCAGAGGAGCCCCACACAGAGTCTCCAGGAGACCCAGAGGTGCAGCA

G AGGCAACCAGAGGTTCAAGAGTCTTCAGAGCCTATCGAGCCCACCCCGCGAATCACCATGGTTAAGCTACAGGCCGAGCAGCAGAGAATCTCCTTCCC

AGCCAACTGCCCAGACACCATGGCTTCTGCCCCCATCGCTGCCAGCCCACCTGTGAAGGAGAAGCTGAGAGTGACCAGTGCAG AGATCAAACTTGGGAA

GAATCGGACAGAGGCGGAAGTAAAGCGGTACACGGAGGAGAAGGAGAGGCTGGAGAGGAGCAAGGAGGAGATCCGAGGGCACCTGGCTCAGCTCCGCAGA

GAGAAGCGGGAGCTCAAAGAGACCCTGTTGAGATGCACAG ATAAGGGGGTCCTGGCCAAGCTGGAGCAGACACTGAAGAAAATAGACGAGGAATGCCGG

ATGGAGGAGAGCAGGCGTGTGGACCTTGAGCTCAGCATCATGGAGGTGAAGGACAACCTGAAGAAGGCAGAGGCTGGGCCCGTGACCCTGGGCACCACTG

TGGATACCACGCACCTGGACAACATGAGCCCTCGT CCACAGCCCAAAGCTGCCACCCCCAACCCCCCACCAGACTCCACGCCAGTCAACTCTGCATCTG

TGCTCAAGAACAGGCCTCTTTCCGTCATGGTCACAGGCAAAGGCACTGTCCTGCAGAAAGCCAAG GAATGGGAGAAGAAAGGAGCCAGTTAGGAGACAA

GAATTGCCTAAAGACTCTTATGTGACTGTGGACCTTGGTGACAATCCTGCTCTGGACAAGTCTTCAATAAAACAGCAACTCTGAGGAAAGGTGAGTCTGT

TTACAAGACAAAGCAAGGGATGAGGCGCTCGCTGCAAACGGAGCTTCGGTTAAGAGAAGGCCCTGTCTCCTCCTCAAGCCAAAGGGATCCCAGCAGCAGC

ATCGTGGTGGCATCTTTGGAGTCGAAATCTACTGGCTGTCAATGAGACAATGTACCTTCCCTTTTCTTTTTAAAGATTTCATCCATCACTCAACTGTTTT

ACCAAGATTTTTCAGGTGTGAAAAAATGACCACATTGCTTCTGGTTATGAGAAAAATCTAAATTCCTGACCCCCTTATCTTTCATCCTGTATTTGGCAAT

GTTGAGGTTTAAATCATGCATTGTCTTCATGTTTGCCCAAATTGGGTGGGCTCCATGTGGTCTCTGATGGTCTTAAAGAACATTAGAACCCTGTAATCAG

TAGAAGAGGGACATATTGGGAACCAAGCCAAGGCACTGACCCCCTTGGGGTCACTAAGGACTTCCCCCCAGTCCAGGAAAACTTTAAACAATGCTGTATT

ATATAGGGGGAAAATTCCTGTGTTTACAGACTGTCCTGTGGCCAGGCCACTTTTAAGAGTTGGTCAATTACCTCTTCATTACCATTGTAAAGATGTTTTA

AATTTCTGGTCCCCTTGCAAGGAAAACAGCCGTGAATTAGCCTGTCTAGTCTGTCAGACTGGCAGCCAGTGCTGTCTTTATGTGCTGTCTCTCTGGGACA

GCACTAGCACAAGTTGATACATTTCATCTGTTACCTGCCCCATTTCTGAGCATTTGGAACTAGTTACCTAACACTGGTTTCTGAAGGCTAAATGTTTTTA

CGCATATATTATTGTCTTTCTAATCCCAGGGCATTTATTTCCTGTATCATAAACACTTGGTGACCTTTATCAAGTGGTGAGTTAGAATTTTTTTTTTAAA

TAAAATGTTCATTGT
Translation
NCYKA ALEQLLTELDDFLKVLDQENLSSAAVLKKSGLSELLRLYTKSSS SSDEEYIYMNKVSVNGEQNSASPDKV VPEEQGPLTNGEPSQHSSAPQK

SLPDLPPPKM IPERKQPTVPKIESPEGYYEEAEPFDRSINE EDGEAVSSSYESYDEDENSKGKAAPYQWPSPEASIELMRDARICAFLWRKKWLGQWA

KQLCVIRDTRLL CYKSSKDHSPQLDVNLRGSSVVHKEKQVRKKGHKLKITPMNADVIVLGLQSKDQAEQWLR VIQEVSGLPSEGASEGNQYTPDAQRL

NCQK PDIAEKYLSAAEYGITINGHPEIPETKDV VKKKCSAGLKLSNLMNLGRKKSTSLEPPERSLETSS SYLNVLVNSQWKSRWCFVRDSHLHFYQD

RNRSKVAQQPLSLVGCDVLPDPSPDHLYSFRILHNGEELAKLE AKSSEEMGHWLGLLLSESGSKTDPEELTYDYVDAERVSCIVSAAKTSLL LLMQRK

FSEPNTYIDGLPSRDCQDDLYDDVEVSELIAV VEPAEEAAPAVDANSGSEPDRVYLDLTPVKSFLHSSSEAQAQASLPAVPHQDDVAETLTVDPKPGTT

PEEPHTESPGDPEVQQ RQPEVQESSEPIEPTPRITMVKLQAEQQRISFPANCPDTMASAPIAASPPVKEKLRVTSAE EIKLGKNRTEAEVKRYTEEKE

RLERSKEEIRGHLAQLRREKRELKETLLRCTD DKGVLAKLEQTLKKIDEECRMEESRRVDLELSIMEVKDNLKKAEAGPVTLGTTVDTTHLDNMSPR P

QPKAATPNPPPDSTPVNSASVLKNRPLSVMVTGKGTVLQKAK EWEKKGAS
Transcript ENSMUST00000118800
Sequence
CGGAGCCGATAGCAGCGCACACCGTGCCCGGGATGGAGCGCTACAAAG - UNI36646 - CCCTGGAGCAGCTGCTGACAGAGCTGGACGACTTCCTT

AAGGTCCTCGACCAGGAGAACCTGAGCAGTGCAGCCGTGCTGAAGAAGAGCGGCCTGTCAGAGCTCCTGCGGCTTTACACCAAGAGCAGCA GTTCTGAT

GAGGAGTATATTTACATGAACAAAGTGTCAGTCAACGGGGAACAAAACTCAGCATCTCCAGACAAAG TTCCCGAGGAGCAGGGTCCACTGACCAATGGG

GAGCCCAGCCAGCATTCCTCAGCCCCTCAGAAGAGCCTTCCAGACCTCCCTCCGCCCAAGATG ATTCCAGAGAGGAAACAGCCCACCGTTCCAAAGATC

GAGTCCCCTGAGGGCTACTATGAAGAGGCTGAGCCATTTGACAGATCCATCAATG AGGATGGAGAGGCTGTGAGCAGCTCCTACGAGTCCTACGATGAG

GACGAGAACAGCAAAGGCAAGGCTGCCCCCTACCAGTGGCCCTCGCCCGAGGCCAGCATTGAGCTGATGCGTGATGCCCGCATCTGTGCCTTCCTGTGGC

GCAAGAAGTGGCTAGGCCAGTGGGCCAAGCAGCTCTGTGTGATCAGGGACACCAGGCTCTTG TGCTACAAATCGTCCAAAGACCACAGTCCTCAGCTGG

ACGTGAACCTGCGGGGCAGCAGCGTCGTGCACAAGGAGAAGCAAGTGCGGAAGAAAGGACACAAGCTCAAGATCACACCGATGAACGCTGACGTTATCGT

GCTGGGCCTGCAGAGCAAGGACCAAGCTGAGCAGTGGCTTCGG GTCATCCAGGAGGTGAGTGGCCTGCCTTCTGAAGGAGCCTCAGAGGGAAACCAGTA

CACACCAGATGCCCAGCGCCTCAACTGTCAGAAA CCAGACATAGCTGAGAAGTACCTGTCAGCAGCGGAGTACGGGATCACCATCAACGGCCACCCTGA

GATCCCAGAGACCAAAGATG TCAAGAAGAAATGCTCTGCTGGCCTCAAGCTGAGCAACCTTATGAACCTGGGCAGGAAGAAATCTACCTCGCTGGAGCC

CCCGGAGAGATCCCTTGAGACATCCA GCTACCTGAATGTGCTGGTGAACAGTCAATGGAAGTCACGCTGGTGCTTCGTTAGAGACAGCCACCTGCACTT

CTACCAGGACCGGAACCGGAGCAAGGTGGCCCAGCAGCCCCTCAGCCTGGTGGGCTGTGACGTGCTTCCAGATCCTAGCCCCGACCACCTGTATTCCTTC

CGTATTCTCCACAACGGCGAGGAGCTAGCCAAGCTTGAG GCCAAGTCTTCAGAGGAGATGGGCCACTGGCTAGGCCTCCTGCTCTCAGAGTCGGGCTCC

AAGACTGACCCGGAAGAGCTCACCTACGACTATGTGGATGCTGAAAGGGTTTCCTGTATTGTGAGTGCGGCCAAAACCTCTCTCTT ACTGATGCAGAGA

AAGTTCTCAGAGCCCAACACATACATCGATGGCCTGCCCAGCCGGGATTGCCAGGACGATCTGTATGATGATGTGGAGGTATCAGAGCTGATAGCCGTG 

GTGGAGCCTGCCGAGGAAGCCGCCCCTGCTGTCGATGCTAACAGTGGTAGTGAGCCAGACAGAGTCTACCTGGATCTCACACCGGTCAAGTCCTTCCTGC

ACAGTAGCAGTGAGGCTCAGGCGCAGGCCTCTCTCCCAGCAGTGCCACATCAGGACGATGTAGCTGAGACCCTCACAGTAGACCCAAAGCCAGGCACCAC

CCCAGAGGAGCCCCACACAGAGTCTCCAGGAGACCCAGAGGTGCAGCAG AGGCAACCAGAGGTTCAAGAGTCTTCAGAGCCTATCGAGCCCACCCCGCG

AATCACCATGGTTAAGCTACAGGCCGAGCAGCAGAGAATCTCCTTCCCAGCCAACTGCCCAGACACCATGGCTTCTGCCCCCATCGCTGCCAGCCCACCT

GTGAAGGAGAAGCTGAGAGTGACCAGTGCAG AGATCAAACTTGGGAAGAATCGGACAGAGGCGGAAGTAAAGCGGTACACGGAGGAGAAGGAGAGGCTG

GAGAGGAGCAAGGAGGAGATCCGAGGGCACCTGGCTCAGCTCCGCAGAGAGAAGCGGGAGCTCAAAGAGACCCTGTTGAGATGCACAG ATAAGGGGGTC

CTGGCCAAGCTGGAGCAGACACTGAAGAAAATAGACGAGGAATGCCGGATGGAGGAGAGCAGGCGTGTGGACCTTGAGCTCAGCATCATGGAGGTGAAGG

ACAACCTGAAGAAGGCAGAGGCTGGGCCCGTGACCCTGGGCACCACTGTGGATACCACGCACCTGGACAACATGAGCCCTCGT CCACAGCCCAAAGCTG

CCACCCCCAACCCCCCACCAGACTCCACGCCAGTCAACTCTGCATCTGTGCTCAAGAACAGGCCTCTTTCCGTCATGGTCACAGGCAAAGGCACTGTCCT

GCAGAAAGCCAAG GAATGGGAGAAGAAAGGAGCCAGTTAGGAGACAAGAATTGCCTAAAGACTCTTATGTGACTGTGGACCTTGGTGACAATCCTGCTC

TGGACAAGTCTTCAATAAAACAGCAACTCTGAGGAAAGGTGAGTCTGTTTACAAGACAAAGCAAGGGATGAGGCGCTCGCTGCAAACGGAGCTTCGGTTA

AGAGAAGGCCCTGTCTCCTCCTCAAGCCAAAGGGATCCCAGCAGCAGCATCGTGGTGGCATCTTTGGAGTCGAAATCTACTGGCTGTCAATGAGACAATG

TACCTTCCCTTTTCTTTTTAAAGATTTCATCCATCACTCAACTGTTTTACCAAGATTTTTCAGGTGTGAAAAAATGACCACATTGCTTCTGGTTATGAGA

AAAATCTAAATTCCTGACCCCCTTATCTTTCATCCTGTATTTGGCAATGTTGAGGTTTAAATCATGCATTGTCTTCATGTTTGCCCAAATTGGGTGGGCT

CCATGTGGTCTCTGATGGTCTTAAAGAACATTAGAACCCTGTAATCAGTAGAAGAGGGACATATTGGGAACCAAGCCAAGGCACTGACCCCCTTGGGGTC

ACTAAGGACTTCCCCCCAGTCCAGGAAAACTTTAAACAATGCTGTATTATATAGGGGGAAAATTCCTGTGTTTACAGACTGTCCTGTGGCCAGGCCACTT

TTAAGAGTTGGTCAATTACCTCTTCATTACCATTGTAAAGATGTTTTAAATTTCTGGTCCCCTTGCAAGGAAAACAGCCGTGAATTAGCCTGTCTAGTCT

GTCAGACTGGCAGCCAGTGCTGTCTTTATGTGCTGTCTCTCTGGGACAGCACTAGCACAAGTTGATACATTTCATCTGTTACCTGCCCCATTTCTGAGCA

TTTGGAACTAGTTACCTAACACTGGTTTCTGAAGGCTAAATGTTTTTACGCATATATTATTGTCTTTCTAATCCCAGGGCATTTATTTCCTGTATCATAA

ACACTTGGTGACCTTTATCAAGTGGTGAGTTAGAATTTTTTTTTTAAATAAAATGTTCATTG
Translation
MERYKA - UNI36646 - ALEQLLTELDDFLKVLDQENLSSAAVLKKSGLSELLRLYTKSSS SSDEEYIYMNKVSVNGEQNSASPDKV VPEEQGPL

TNGEPSQHSSAPQKSLPDLPPPKM IPERKQPTVPKIESPEGYYEEAEPFDRSINE EDGEAVSSSYESYDEDENSKGKAAPYQWPSPEASIELMRDARI

CAFLWRKKWLGQWAKQLCVIRDTRLL CYKSSKDHSPQLDVNLRGSSVVHKEKQVRKKGHKLKITPMNADVIVLGLQSKDQAEQWLR VIQEVSGLPSEG

ASEGNQYTPDAQRLNCQK PDIAEKYLSAAEYGITINGHPEIPETKDV VKKKCSAGLKLSNLMNLGRKKSTSLEPPERSLETSS SYLNVLVNSQWKSR

WCFVRDSHLHFYQDRNRSKVAQQPLSLVGCDVLPDPSPDHLYSFRILHNGEELAKLE AKSSEEMGHWLGLLLSESGSKTDPEELTYDYVDAERVSCIVS

AAKTSLL LLMQRKFSEPNTYIDGLPSRDCQDDLYDDVEVSELIAV VEPAEEAAPAVDANSGSEPDRVYLDLTPVKSFLHSSSEAQAQASLPAVPHQDD

VAETLTVDPKPGTTPEEPHTESPGDPEVQQ RQPEVQESSEPIEPTPRITMVKLQAEQQRISFPANCPDTMASAPIAASPPVKEKLRVTSAE EIKLGKN

RTEAEVKRYTEEKERLERSKEEIRGHLAQLRREKRELKETLLRCTD DKGVLAKLEQTLKKIDEECRMEESRRVDLELSIMEVKDNLKKAEAGPVTLGTT

VDTTHLDNMSPR PQPKAATPNPPPDSTPVNSASVLKNRPLSVMVTGKGTVLQKAK EWEKKGAS
Transcript ENSMUST00000111584
Sequence
GAGAACTCAGCGCGGAGCCGATAGCAGCGCACACCGTGCCCGGGATGGAGCGCTACAAAG - UNI36646 - CACAGGGCTGTTGCTGTCTGGTGGTG

CAGAGAAGAATCCTGCAGGTCTCTGCTT - UNI36646 - CCCTGGAGCAGCTGCTGACAGAGCTGGACGACTTCCTTAAGGTCCTCGACCAGGAGAA

CCTGAGCAGTGCAGCCGTGCTGAAGAAGAGCGGCCTGTCAGAGCTCCTGCGGCTTTACACCAAGAGCAGCA GTTCTGATGAGGAGTATATTTACATGAA

CAAAGTGTCAGTCAACGGGGAACAAAACTCAGCATCTCCAGACAAAG TTCCCGAGGAGCAGGGTCCACTGACCAATGGGGAGCCCAGCCAGCATTCCTC

AGCCCCTCAGAAGAGCCTTCCAGACCTCCCTCCGCCCAAGATG ATTCCAGAGAGGAAACAGCCCACCGTTCCAAAGATCGAGTCCCCTGAGGGCTACTA

TGAAGAGGCTGAGCCATTTGACAGATCCATCAATG AGGATGGAGAGGCTGTGAGCAGCTCCTACGAGTCCTACGATGAGGACGAGAACAGCAAAGGCAA

GGCTGCCCCCTACCAGTGGCCCTCGCCCGAGGCCAGCATTGAGCTGATGCGTGATGCCCGCATCTGTGCCTTCCTGTGGCGCAAGAAGTGGCTAGGCCAG

TGGGCCAAGCAGCTCTGTGTGATCAGGGACACCAGGCTCTTG TGCTACAAATCGTCCAAAGACCACAGTCCTCAGCTGGACGTGAACCTGCGGGGCAGC

AGCGTCGTGCACAAGGAGAAGCAAGTGCGGAAGAAAGGACACAAGCTCAAGATCACACCGATGAACGCTGACGTTATCGTGCTGGGCCTGCAGAGCAAGG

ACCAAGCTGAGCAGTGGCTTCGG GTCATCCAGGAGGTGAGTGGCCTGCCTTCTGAAGGAGCCTCAGAGGGAAACCAGTACACACCAGATGCCCAGCGCC

TCAACTGTCAGAAA CCAGACATAGCTGAGAAGTACCTGTCAGCAGCGGAGTACGGGATCACCATCAACGGCCACCCTGAGATCCCAGAGACCAAAGATG

 TCAAGAAGAAATGCTCTGCTGGCCTCAAGCTGAGCAACCTTATGAACCTGGGCAGGAAGAAATCTACCTCGCTGGAGCCCCCGGAGAGATCCCTTGAGA

CATCCA GCTACCTGAATGTGCTGGTGAACAGTCAATGGAAGTCACGCTGGTGCTTCGTTAGAGACAGCCACCTGCACTTCTACCAGGACCGGAACCGGA

GCAAGGTGGCCCAGCAGCCCCTCAGCCTGGTGGGCTGTGACGTGCTTCCAGATCCTAGCCCCGACCACCTGTATTCCTTCCGTATTCTCCACAACGGCGA

GGAGCTAGCCAAGCTTGAG GCCAAGTCTTCAGAGGAGATGGGCCACTGGCTAGGCCTCCTGCTCTCAGAGTCGGGCTCCAAGACTGACCCGGAAGAGCT

CACCTACGACTATGTGGATGCTGAAAGGGTTTCCTGTATTGTGAGTGCGGCCAAAACCTCTCTCTT ACTGATGCAGAGAAAGTTCTCAGAGCCCAACAC

ATACATCGATGGCCTGCCCAGCCGGGATTGCCAGGACGATCTGTATGATGATGTGGAGGTATCAGAGCTGATAGCCGTG GTGGAGCCTGCCGAGGAAGC

CGCCCCTGCTGTCGATGCTAACAGTGGTAGTGAGCCAGACAGAGTCTACCTGGATCTCACACCGGTCAAGTCCTTCCTGCACAGTAGCAGTGAGGCTCAG

GCGCAGGCCTCTCTCCCAGCAGTGCCACATCAGGACGATGTAGCTGAGACCCTCACAGTAGACCCAAAGCCAGGCACCACCCCAGAGGAGCCCCACACAG

AGTCTCCAGGAGACCCAGAGGTGCAGCAG AGGCAACCAGAGGTTCAAGAGTCTTCAGAGCCTATCGAGCCCACCCCGCGAATCACCATGGTTAAGCTAC

AGGCCGAGCAGCAGAGAATCTCCTTCCCAGCCAACTGCCCAGACACCATGGCTTCTGCCCCCATCGCTGCCAGCCCACCTGTGAAGGAGAAGCTGAGAGT

GACCAGTGCAG AGATCAAACTTGGGAAGAATCGGACAGAGGCGGAAGTAAAGCGGTACACGGAGGAGAAGGAGAGGCTGGAGAGGAGCAAGGAGGAGAT

CCGAGGGCACCTGGCTCAGCTCCGCAGAGAGAAGCGGGAGCTCAAAGAGACCCTGTTGAGATGCACAG ATAAGGGGGTCCTGGCCAAGCTGGAGCAGAC

ACTGAAGAAAATAGACGAGGAATGCCGGATGGAGGAGAGCAGGCGTGTGGACCTTGAGCTCAGCATCATGGAGGTGAAGGACAACCTGAAGAAGGCAGAG

GCTGGGCCCGTGACCCTGGGCACCACTGTGGATACCACGCACCTGGACAACATGAGCCCTCGT CCACAGCCCAAAGCTGCCACCCCCAACCCCCCACCA

GACTCCACGCCAGTCAACTCTGCATCTGTGCTCAAGAACAGGCCTCTTTCCGTCATGGTCACAGGCAAAGGCACTGTCCTGCAGAAAGCCAAG GAATGG

GAGAAGAAAGGAGCCAGTTAGGAGACAAGAATTGCCTAAAGACTCTTATGTGACTGTGGACCTTGGTGACAATCCTGCTCTGGACAAGTCTTCAATAAAA

CAGCAACTCTGAGGAAAGGTGAGTCTGTTTACAAGACAAAGCAAGGGATGAGGCGCTCGCTGCAAACGGAGCTTCGGTTAAGAGAAGGCCCTGTCTCCTC

CTCAAGCCAAAGGGATCCCAGCAGCAGCATCGTGGTGGCATCTTTGGAGTCGAAATCTACTGGCTGTCAATGAGACAATGTACCTTCCCTTTTCTTTTTA

AAGATTTCATCCATCACTCAACTGTTTTACCAAGATTTTTCAGGTGTGAAAAAATGACCACATTGCTTCTGGTTATGAGAAAAATCTAAATTCCTGACCC

CCTTATCTTTCATCCTGTATTTGGCAATGTTGAGGTTTAAATCATGCATTGTCTTCATGTTTGCCCAAATTGGGTGGGCTCCATGTGGTCTCTGATGGTC

TTAAAGAACATTAGAACCCTGTAATCAGTAGAAGAGGGACATATTGGGAACCAAGCCAAGGCACTGACCCCCTTGGGGTCACTAAGGACTTCCCCCCAGT

CCAGGAAAACTTTAAACAATGCTGTATTATATAGGGGGAAAATTCCTGTGTTTACAGACTGTCCTGTGGCCAGGCCACTTTTAAGAGTTGGTCAATTACC

TCTTCATTACCATTGTAAAGATGTTTTAAATTTCTGGTCCCCTTGCAAGGAAAACAGCCGTGAATTAGCCTGTCTAGTCTGTCAGACTGGCAGCCAGTGC

TGTCTTTATGTGCTGTCTCTCTGGGACAGCACTAGCACAAGTTGATACATTTCATCTGTTACCTGCCCCATTTCTGAGCATTTGGAACTAGTTACCTAAC

ACTGGTTTCTGAAGGCTAAATGTTTTTACGCATATATTATTGTCTTTCTAATCCCAGGGCATTTATTTCCTGTATCATAAACACTTGGTGACCTTTATCA

AGTGGTGAGTTAGAATTTTTTTTTTAAATAAAATGTTCATTGT
Translation
MERYKA - UNI36646 - AQGCCCLVVQRRILQVSAS - UNI36646 - SLEQLLTELDDFLKVLDQENLSSAAVLKKSGLSELLRLYTKSSS SS

DEEYIYMNKVSVNGEQNSASPDKV VPEEQGPLTNGEPSQHSSAPQKSLPDLPPPKM IPERKQPTVPKIESPEGYYEEAEPFDRSINE EDGEAVSSSY

ESYDEDENSKGKAAPYQWPSPEASIELMRDARICAFLWRKKWLGQWAKQLCVIRDTRLL CYKSSKDHSPQLDVNLRGSSVVHKEKQVRKKGHKLKITPM

NADVIVLGLQSKDQAEQWLR VIQEVSGLPSEGASEGNQYTPDAQRLNCQK PDIAEKYLSAAEYGITINGHPEIPETKDV VKKKCSAGLKLSNLMNLG

RKKSTSLEPPERSLETSS SYLNVLVNSQWKSRWCFVRDSHLHFYQDRNRSKVAQQPLSLVGCDVLPDPSPDHLYSFRILHNGEELAKLE AKSSEEMGH

WLGLLLSESGSKTDPEELTYDYVDAERVSCIVSAAKTSLL LLMQRKFSEPNTYIDGLPSRDCQDDLYDDVEVSELIAV VEPAEEAAPAVDANSGSEPD

RVYLDLTPVKSFLHSSSEAQAQASLPAVPHQDDVAETLTVDPKPGTTPEEPHTESPGDPEVQQ RQPEVQESSEPIEPTPRITMVKLQAEQQRISFPANC

PDTMASAPIAASPPVKEKLRVTSAE EIKLGKNRTEAEVKRYTEEKERLERSKEEIRGHLAQLRREKRELKETLLRCTD DKGVLAKLEQTLKKIDEECR

MEESRRVDLELSIMEVKDNLKKAEAGPVTLGTTVDTTHLDNMSPR PQPKAATPNPPPDSTPVNSASVLKNRPLSVMVTGKGTVLQKAK EWEKKGAS

For any suggestions or comments, please send an email to unitrap@crg.es