Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025171 (Ubtd1)
Chromosomal location
Chr 19: 42056253 - 42109131 (+)
Description
ubiquitin domain containing 1 Gene [Source:MGI Symbol;Acc:MGI:2385092]
RefSeq_dna
NM_145500 
RefSeq_peptide
NP_663475.1 
UniGene
Mm.22948 
MGI
MGI:2385092 
Uniprot/SWISSPROT
Q91WB7 
Human Ortholog
ENSG00000165886 (UBTD1)
Omim not available
UniTrap UNI14313
Vector Insertion
Chr 19: 42056499 - 42106378
Public Clones (sanger) D050A05 (ggtc) CMHD-GT_534B7-5S (cmhd) CMHD-GT_534B7-3 (cmhd)
CMHD-GT_503D8-3 (cmhd) FHCRC-GT-S20-12A1 (fhcrc) IST15088G11 (tigm)
IST14818D11 (tigm)
Private Clones OST432676 (lexicon) OST427704 (lexicon) OST386089 (lexicon) OST368604 (lexicon)
OST367849 (lexicon) OST356489 (lexicon) OST333352 (lexicon) OST330410 (lexicon)
OST242967 (lexicon) OST99786 (lexicon) OST95879 (lexicon) OST90124 (lexicon)
OST73846 (lexicon) OST55197 (lexicon) OST45511 (lexicon) OST42778 (lexicon)
OST36309 (lexicon) OST31044 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23282
Vector Insertion
Chr 19: 42106607 - 42108078
Public Clones not available
Private Clones OST267355 (lexicon) OST128398 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000026170
Sequence
GCAAAGTTTGTGGCGAAGCCGGCGTCGGGCAGAGCGCTCCCCAGGGGAGATCCAGGAGCTCTCGATGTCGGGCTGCGGGAGTCGTTGACCCGGGGACGCC

GCGGTTCGGGGCAGCAGCGTGGAGCAGCCGGCCGACCGCCGCCTCTGGTGCATGGGGGACCGGCTGAGAAGCCAGCATGGGCAACTGCGTGGGGAGACAG

CGCCGGGAGAGGCCGGCTGCTCCGGGACACCCCCGCAAGCGAGCAG - UNI14313 - GTCGCAATGAGCCCTTGAAGAAGGAGCGGCTCAAGTGGAA

GAGTGACTATCCCATGACTGATGGGCAGCTGCGGAGCAAACGAGATGAGTTCTGGGACACAGCACCTGCCTTTGAGGGCCGCAAGGAGATCTGGGATGCC

CTCAAGGCTGCTGCCTATGCTGCTGAAGCTAATGACCATGAGCTGGCTCAGGCCATCCTGGATGGAGCCAGCATCACCCTGCCTCATG - UNI23282 

- GAACTCTTTGTGAATGCTATGACGAGCTGGGTAACCGCTATCAACTGCCCATCTATTGCCTGTCCCCACCTGTGAACTTGCTGCTGGAGCACACGGAG

GAGGAGAGCCTGGAGCCTCCCGAGCCCACCCCTAGTGTGCGCCGTGAATTCCCACTGAAAGTGCGCCTCTCCACAGGCAAGGACGTGAGGCTCAATGCCA

GCCTGCCTGACACGGTGGGGCAACTCAAGAGGCAGCTGCACAGCCAGGAGGGCATTGAGCCATCCTGGCAGAGATGGTTCTTCTCTGGGAAGCTGCTTAC

AGACCGCACAAGGCTCCAGGAAACAAAGATTCAAAAAGACTTCGTCATCCAGGTCATCATCAACCAGCCCCCACCACCCCAGGACTGACGGACTGACGGA

CTGACGGCACCAACTCCTAGGAAAAGAGGCCATGGGGGGCCCTGCAGGCTGTGGGGCCCAGTCCTGCCGCCTTCCAGTGCTGCTGTCTTCTTCAGGGGCG

CCTCCCACCGCCCTGCTGTATGGCTCTTAGTGAGCTGCGAAGGGACTTGCCCTCTGGGGCACTGGATCCACCAGTGCTCAGCACCCAGGGAGCAGTGCTG

CCTGCCACACACAGGCCTTGCCAACCTTGGAGAAAAGGCACATGGCACTCTCCACCACAGGTTGGAGCCATGGGGGCCGTCCTGGCGACCTGTCATCTGG

TGCCACGCTGTGCTCACTCCAGTTTTCTGCTCAGGGTTGGAAGCAATTGCTGTCTCCCCTTTATCCCTCACCATGACTCTGCCCTGGGCACAGTGCCAGT

CCCCTGGATGGGGAGGGAGCCCGGTGGGCCCCAGGGCTTAAGGAGCTTCAGGTGGGCCTCTCTGCCTCTCCCTGCACCCAGCACAATCTGCAGAGATGAG

GCGGGTGGCTGGATAGCCAGGCTTCATGGCAGGGGTTTGCACAGGGCTGTCCCCAACTGTAACCCAGGCAGGGTGGGGTCCGAAGCCTGGTCATAGCCCA

GCGGGGCCCTGTGTACAGACACATCTGCATTTTATCAATAAAGCCTTTGCTCCTC
Translation
MGNCVGRQRRERPAAPGHPRKRAG - UNI14313 - GRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDHEL

AQAILDGASITLPHG - UNI23282 - GTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPEPTPSVRREFPLKVRLSTGKDVRLNASLPDT

VGQLKRQLHSQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD

For any suggestions or comments, please send an email to unitrap@crg.es