Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025232 (Hexa)
Chromosomal location
Chr 9: 59387504 - 59412914 (+)
Description
hexosaminidase A Gene [Source:MGI Symbol;Acc:MGI:96073]
RefSeq_dna
NM_010421 
RefSeq_peptide
NP_034551.2 
UniGene
Mm.2284 
MGI
MGI:96073 
Uniprot/SWISSPROT
P29416 
Uniprot/SPTREMBL
Q3THQ0 Q3TKF6 Q3TVI2 Q3TW10 Q3TXV7 Q3U936 Q3UCP6 Q8BNS6 Q91XG3 
Human Ortholog
ENSG00000213614 (HEXA)
Omim 272800 - TAY-SACHS DISEASE  
UniTrap UNI2797
Vector Insertion
Chr 9: 59387784 - 59401939
Public Clones AH0307 (sanger) AF0619 (sanger) M076C07 (ggtc) M077E01 (ggtc) M076C02 (ggtc)
M076E04 (ggtc) M076A04 (ggtc) M076C03 (ggtc) M076D06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18855
Vector Insertion
Chr 9: 59404726 - 59405094
Public Clones not available
Private Clones OST412942 (lexicon) OST364866 (lexicon) OST364588 (lexicon) OST356419 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25961
Vector Insertion
Chr 9: 59411795 - 59412627
Public Clones not available
Private Clones OST149129 (lexicon)
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000026262
Sequence
GCTGGAAGGGGAGCTGGCCGGTGGGCCATGGCCGGCTGCAGGCTCTGGGTTTCGCTGCTGCTGGCGGCGGCGTTGGCTTGCTTGGCCACGGCACTGTGGC

CGTGGCCCCAGTACATCCAAACCTACCACCGGCGCTACACCCTGTACCCCAACAACTTCCAGTTCCGGTACCATGTCAGTTCGGCCGCGCAGGCGGGCTG

CGTCGTCCTCGACGAGGCCTTTCGACGCTACCGTAACCTGCTCTTCGGTTCCGGCTCTTGGCCCCGACCCAGCTTCTCAA - UNI2797 - ATAAACA

GCAAACGTTGGGGAAGAACATTCTGGTGGTCTCCGTCGTCACAGCTGAATGTAATGAATTTCCTAATTTGGAGTCGGTAGAAAATT ACACCCTAACCAT

TAATGATGACCAGTGTTTACTCGCCTCTGAGACTGTCTGGGGCGCTCTCCGAG GTCTGGAGACTTTCAGTCAGCTTGTTTGGAAATCAGCTGAGGGCAC

G - UNI18855 - TTCTTTATCAACAAGACAAAGATTAAAGACTTTCCTCGATTCCCTCACCGGGGCGTACTGCTGGATACATCTCGCCATTACCTGC

CATTGTCTAGCATCCTGGATACACTG GATGTCATGGCATACAATAAATTCAACGTGTTCCACTGGCACTTGGTGGACGACTCTTCCTTCCCATATGAGA

GCTTCACTTTCCCAGAGCTCACCAGAAAG GGGTCCTTCAACCCTGTCACTCACATCTACACAGCACAGGATGTGAAGGAGGTCATTGAATACGCAAGGC

TTCGGGGTATCCGTGTGCTGGCAGAATTTGACACTCCTGGCCACACTTTGTCCTGGGGGCCAG GTGCCCCTGGGTTATTAACACCTTGCTACTCTGGGT

CTCATCTCTCTGGCACATTTGGACCGGTGAACCCCAGTCTCAACAGCACCTATGACTTCATGAGCACACTCTTCCTGGAGATCAGCTCAGTCTTCCCGGA

CTTTTATCTCCACCTGGGAGGGGATGAAGTCGACTTCACCTGCTG GAAGTCCAACCCCAACATCCAGGCCTTCATGAAGAAAAAGGGCTTTACTGACTT

CAAGCAGCTGGAGTCCTTCTACATCCAGAC GCTGCTGGACATCGTCTCTGATTATGACAAGGGCTATGTGGTGTGGCAGGAGGTATTTGATAATAAAGT

GAAG GTTCGGCCAGATACAATCATACAGGTGTGGCGGGAAGAAATGCCAGTAGAGTACATGTTGGAGATGCAAGATATCACCAGGGCTGGCTTCCGGGC

CCTGCTGTCTGCTCCCTGGTACCTGAACCGTGTAAAGTATGGCCCTGACTGGAAGGACATGTACAAAGTGGAGCCCCTGGCGTTTCATG GTACGCCTGA

ACAGAAGGCTCTGGTCATTGGAGGGGAGGCCTGTATGTGGGGAGAGTATGTGGACAGCACCAACCTGGTCCCCAGACTCTG GCCCAGAGCGGGTGCCGT

CGCTGAGAGACTGTGGAGCAGTAACCTGACAACTAATATAGACTTTGCCTTTAAACGTTTGTCGCATTTCCGTTGTGAGCTGGTGAG - UNI25961 -

 GAGAGGAATCCAGGCCCAGCCCATCAGTGTAGGCTACTGTGAGCAGGAGTTTGAGCAGACTTGAGCCACCAGTGCTGAACACCCAGGAGGTTGCTGTCC

TTTGAGTCAGCTGCGCTGAGCACCCAGGAGGGTGCTGGCCTTAAGAGAGCAGGTCCCGGGGCAGGGCTAATCTTTCACTGCCTCCCGGCCAGGGGAGAGC

ACCCCTTGCCCGTGTGCCCCTGTGACTACAGAGAAGGAGGCTGGTGCTGGCACTGGTGTTCAATAAAGATCTATGTGGCATTTTCTCT
Translation
MAGCRLWVSLLLAAALACLATALWPWPQYIQTYHRRYTLYPNNFQFRYHVSSAAQAGCVVLDEAFRRYRNLLFGSGSWPRPSFSN - UNI2797 - NK

QQTLGKNILVVSVVTAECNEFPNLESVENY YTLTINDDQCLLASETVWGALRG GLETFSQLVWKSAEGT - UNI18855 - FFINKTKIKDFPRFP

HRGVLLDTSRHYLPLSSILDTL DVMAYNKFNVFHWHLVDDSSFPYESFTFPELTRK GSFNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSW

GPG GAPGLLTPCYSGSHLSGTFGPVNPSLNSTYDFMSTLFLEISSVFPDFYLHLGGDEVDFTCW WKSNPNIQAFMKKKGFTDFKQLESFYIQT TLLD

IVSDYDKGYVVWQEVFDNKVK VRPDTIIQVWREEMPVEYMLEMQDITRAGFRALLSAPWYLNRVKYGPDWKDMYKVEPLAFHG GTPEQKALVIGGEAC

MWGEYVDSTNLVPRLW WPRAGAVAERLWSSNLTTNIDFAFKRLSHFRCELVR - UNI25961 - RRGIQAQPISVGYCEQEFEQT

For any suggestions or comments, please send an email to unitrap@crg.es