Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025241 (Fyco1)
Chromosomal location
Chr 9: 123698628 - 123760687 (-)
Description
FYVE and coiled-coil domain containing 1 Gene [Source:MGI Symbol;Acc:MGI:107277]
RefSeq_dna
NM_148925 
RefSeq_peptide
NP_001103723.1 NP_683727.2 
UniGene
Mm.252941 Mm.401205 
MGI
MGI:107277 
Uniprot/SWISSPROT
Q8VDC1 
Human Ortholog
ENSG00000163820 (FYCO1)
Omim not available
UniTrap UNI34393
Vector Insertion
Chr 9: 123732295 - 123734795
Public Clones IST12227E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000084715
Sequence
GCCGCCCTGTGAGGCGGAGCTTCGGCAGCTCTCCCCGAACCCCTGGCACAGCAGCCAAACCCCGAAGTTCTCGCGGGCACTGGGACTTGATCCCCAGAAA

GCCAAACCCTCCTCTCTGCAGGACTCCTGACGCCCCTTCGGTCCAGGAGACACA GGCTTCCTTGCCCCACCTCCTGAAACCTGAAGGGGGCCATAGCAC

TGAGTGAGAGAGAGCTGGCACATGTTAGACAGATTCAAGGTGACATGTTACTGTGAACTGCTGAAATTCAAG GTGCTACCATGGAGTCTGACCATTGCT

GACCAGCAGCCACACAGCACTGAAGTGATAGCCTGCTTGGACCTACACATCTAAGAAAGAGGAAAGCCATGGCTTCTAGCAGCACTGAGACTCAGCTCCA

GAGGATCATCCGTGATCTACAAG ATGCAGCGACAGAACTAAGCCATGAATTTAAGGAAGGCGGAGAGCCAATCACAGATGACAGCACCAGTTTGCACAA

GTTTTCTTACAAACTTGAGTATCTTCTGCAA TTTGATCAGAAGGAGAAGGCGAGCCTCCTGGGAAGCAAGAAAGACTACTGGGATTACTTTTGTGCGTG

CCTAGCCAAGGTGAAAGGAGCAAATGATGGCATTCGATTTGTCAGGTCCATCTCTGAG CTCCGAACATCTCTGGGGAAAGGGAGAGCCTTCATTCGCTA

CTCTTTGGTGCACCAGAGGCTGGCAGACACCTTGCAGCAGTGCTTCATGAACACTAAAGTGACCAG TGACTGGTATTATGCAAGAAGCCCCTTTCTGAA

GCCAAAGCTGAGCTCTGACATTGTGGGTCAACTGTATGAGCTGACTGAGGTTCAGTTTGATCTAGCACCAAGAGGCTATGACTTGGATGCCGCCTGGCCA

ACATTTGCCAG GAGGACGCTAGCCACCAGCACGTCTGCTTACATGTGGAAACCCCCCAGCCGAAGCTCCAGCATGAGTAGTTTAGTGAGCAACTACTTG

CAG ACTCAGGAGATGGCCTCCAGTCTTGACCTGAATTGTTCTCTAAACAATGAAGCACTAGAAAGCTTCGACGAGATGCGGCTGGAGCTGGACCAGTTG

GAGGTTCGGGAGAAACAGCTACAAGAACGTGTACAGCAGCTAGACAGGGAGAACCAAGCACTGCGAATGTTGGTCAGCAGACAAGGGGGGCAGCTTCAGG

TAGAGAAGGAGATGGGGTACCTTGCAGTCGAGGACAGCATTGGCCTTGTGAGCCTGGTAGCAGAACTCCAGAAGCAGGGGGACGTCAGCCAGGCCACAGT

GAAGAAGCTACAGTCATGTCTGCAGGCCTTGGAGCTAAATGTAGACAAGAAAGAGTACAGTCCCTCAGCCTTGCAGCTTGAGAACATGGCGAAGGAGCTT

GACACTGTGAGAGGCTCCTTGGGTAGGGAGAACCAGCTCCTGGCCAGCCTTTCAGAGCGCCTTGCTAGGGCAGAGAAAGGGGAAAAGACACCTCCAGACA

CAGAGCTTCATCAGGAGCCAGTTCCTGCGGATCTGGTGCTCAAGTTCCAGGAGCTGAAGGGAAAACTTCAAGCCCTAGAAGGAGAGAACACCGAGGCCCA

GGAGCTCAACAGGCAGCAGAGTATCAAGCTAGAGCAACTGGCCAAGGAACTACAGCTGAAGGAGGAGGCCCGGGCTAGCCTAGCACACTTAGTGAAGGAT

GTGGTCCCACTTCAGGAAGAGCTGTCTGGAAAGAAGCAAGAGTCAGCTCAGCTCCGACGACAGCTTCAGGAATCCCTGGCCCACTTGAGCTCTGTGGAGG

AGGAGCTGGCTGAAGCCAGGCAGCAGGAAAAGCAGCATCGAGAAGAAAAGCAGCTACTGGAGCAGGAAGCCACGTCTCTTACATGGCAGCTGCAGCTCCT

AGAGACCCAGCTAGGACAGGTGAGTCAGCTTGTAAGTGACCTGGAGGAGCAGAAGAAGCAACTCATGCAGGAGAGAGACCATCTCAGCCAGAGAGTGGGC

ACACTGGAGCAGCTAGCCGAGGTGCATGGCCCGCCACAGTCTGCGGAGATGCCGGAAAAGAGGCAGCAGTGCCTCCGGGAAGAACAGGTAAACAATAGCA

CAGTGTCAGAGGCAGAGCAGGAGGAGTTGCAGAAGGAGCTGCAGAACATGGTTGACCGCAACCAGCTCCTCGAAGGCAAACTGCAGGCCTTGCAAACTGA

CTATAAGGCACTGCAGCAGCGAGAGGCAGCAATCCAGGGCTCTTTAGCCTCCCTGGAAGCTGAACAGGCTAGCATCCGGCACCTGGGAAACCAGATGGAA

GCAAGCCTCCTGGCTGTGAAGAAAGCCAAAGAGACTATGAAAGCCCAGGTGGCAGAGAAGGAGGCTGCCCTGCAGAGTAAGGAGAGTGAGTGCCAGAGGC

TGCAGGAAGAGGCAGATCAGTGCCGGCTTCAGGCAGAGGCCCAGGCCCAGGAGCTCAGAGCTCTTGAGAACCAGTGCCAGCAGCAGATTCAGCTGATTGA

GGTCCTCTCTGCAGAGAAAGGCCAACAGGGACTCAGCCTGCCCCAAGTCAACACAGACCAACTGGCCCTGTCTCAAGCACAGCTGGAAATCCACCAGGGG

GAAGCCCAGCGGTTACAGAATGAGGTGGTGGACCTCCAGGCCAAGCTCCAGGTGGCCCTAGGTGATCGAGACAAGTTACAGAGCCAGCTGGGTGTGGCTG

AGACAGTTCTAAGGGAGCACAAGACCCTGGTGCAACAACTGAAAGAGCAGAATGAAGCCCTCAACAGGGCCCATGTTCAGGAGCTGCTTCAGTGCTCAGA

GAGAGAGGGGATACTACAGGAGGAGAGCATCTACAAGGCCCAGAAGCAGGAACAAGAGCTACGAGCCCTGCAGGCAGAGCTGTCACAGGTGAGGTGCAGC

TCTGAGGGAGCCCACCTGGAACATGCAGAGCTGCAAGACCAGCTGCACCGAGCCAACACAGACACAGCTGAGCTTGGTATACAGGTCTGTGCACTGACAG

CTGAGAAGGATCGAATGGAGGAGGCCCTGGCCAGCCTAGCCCAGGAGCTCCAGGACTCCAAAGAGGCAGCACTACAGGAACGAAAGGGCTTGGAGCTCCA

AGTGATGCAACTTCAGCAAGAGAAGGAGAAGTTGCAGGAAAAGGTGAAGGCAGCTGAGGAGGCAGCCAGTTCATTCTCTGGTCTGCAGGCACAGCTGGCC

CAGGCTGAGCAGCTAGCCCAGAGCCTCCAAGAGACTGCACACCAGGAACAAGATGCCCTCAAGTTCCAACTAAGTGCTGAGATTATGGACCACCAGAACC

GATTAAAG ACAGCCAATGAAGAGTGTGGGCACCTCAGGGCCCAGCTAGAAGAACAAGGCCAGCAGCTGCAAATGACTAAGGAGGCTGTGCAGGAACTGG

AG ATCACCAAGGCGGCCATGGAGGAGAAGCTGAATTGCACCAGTAGCCACCTTGCAGAGTGCCAGGCCACTTTACTGCGCAAAGATGAAGAAAGCACTA

TGCTTCAAACCAGTCTAGAAAG - UNI34393 - AACACAGAAGGAACTTGAAAAGGCTACATCAAAAATTCAAGAATATTACAACAAACTCTGCCAA

GAGGTGACAAACAGGGAAAGGAATGACCAGAAGATGCTTGCAGACCTCGATGACCTGAACAGAACCAAGAAATACCTTGAGGAGCGGCTGATAGAGCTGC

TCAG - UNI34393 - GGACAAAGATGCTCTCTGGCAAAAATCCGATGCACTGGAAGAATTCCAGCAGAAGCTCAGTGCTGAAGAGAAATGTCTTGGG

GACATGGAAGTCAACCACTGCCATGACTGCAAGCGGGAGTTCAGCTGGATAGTGCGACGGCACCACTGCAG - UNI34393 - GATATGTGGCCGTAT

CTTCTGTTACTACTGCTGTAATAACTATGTTGTGACTAAGCCCAGTGGCAAGAAGGAACGCTGCTGCCGAGCCTGCTTCCAGAAGTTCGGCGAAGGCTCT

GGATCCAATGATAGCAGTGGTTCAGGCACTAGCCAGGGAGAGCCCAGCCCCATGGTGTCACCAGCTGAAGCAAGTCCCCAGTCCATAGGAAGCCAAG GG

ATAAACTCAGTCTGCAGACCACCAGACGATGCTGTGTTTGACATCATCACTGATGAAGAACTGTGCCAGATCCAAGAATCTGGCTCCTCCTTGCCTGAAA

CACCCACTGAAACTGATTCAATGGACCCGAATACGGCTGAACA GGACACCACATCAAACTCATTAACCCCTGAAGACACTGAAGACGTGCCCATGGGGC

AAGATGCTGAAATCTGCTTGCTGAAGTCAGGAGAGCTGAT GATCAAATTACCCCTCACAGTAGAGGAGGTCGCCAGCTTCGGGGAGGGCAGCAGGGAGC

TGTTTGTGAGGTCCAGTACCTACAGCCTGATCACCATCACCGTGGCTGAGCCTGGCCTCACCATCAGCTGGGTCTTCTCTTCTGATCCCAAGAGCATCTC

CTTCAGTGTGGTCTTCCAAGAGACAGAAGACACGCCGCTCGACCAGTGCAAG GTCCTCATTCCCACCACCCGATGCAATTCCCACAAGGAGAACATCCG

GGGCCAGCTGAAGGTCCGAATCCCTGGCATCTACTTGCTCATCTTTGACAACACCTTTTCAAG ATTTATCTCCAAAAAAGTGCTTTACCACCTGACTGT

TGACCGGCCTGTGATCTACGATGGAAGCGATTTCCCATAGCATCAGTACCTGAACTCTAATTAGCTCTTCATCATCCACAGGAAACACTACTCCTCCTCA

CCTATCTCATTAAACATGAACACGCACACTCATCCACAAAATTTTAAATATTAAAAAATTAGAAGCAAAAGAAAGAAAATCAGCTGTGCCCCCAGCTCAG

CAGTTCTGCAGCTTTGGCAGAGGCCTTGGGCTCCACAGTGCGCTTGGCTCCATGCAGCCGTTACTCTCAGGTCCCAGAGCCCCTAAGAACAAGGTACAAG

ACTCAGCCTTTTCATCCAAAGTGACACCATTAACCACACCTGGGATCACAGCTGGTAACAATCTACTGTGTGGTATTTTTCAGGCCAGACGTGGTCTTGA

TAGTATATCTACTCTTCAACAGCCAAGATTGTAGGCCAAGGGCCACTGCCCTGGCCACTTTGTGAAGCCTTGGGTAGTCCTAGGAGAAAAACACTACAGG

GTCATCATGTCAAAGATGCCCCCATTCGTTAATTTCCCCATAAGTGGGGTCTGCTTCTTCCACTCAGCGACTTTGGGAGGCCAGAGTTGTTGTGCTGTTC

TCCTGAGCCTTTGTCTGCTCGGGGGCTTTGTTCAGCAAGGCCACTCAGCAGATCTAAATCACCACCACCACCACCACCACACACACACACTCACACACAC

ACACACTCACACTCACACACACACACTCACACACACACACACTCACACACACACACTCACACACACACTCACACACACACACACACACACACTCTCACAC

ACACACACACACACACACACACACACACTCACACACACACACACACACACACTCACACACACACACACTCACACATACACACACACACACACACACACTC

ACACACACACACACTCACACACACACACACACACACACACTCAGGAACCAAACAGAGGTCTAGGAAAAAGCAACTACTACATGAAGGCTTCAGCTCTGCA

TATGGACAGCAGGAGTCCAAATACAGGCTAAGTTCCCTACAGTGGCACCAAAGCTCACGTGTCAGCCTAGAGCCCATCTGTGATTATAAACTAGAGTTTC

TGCCTCAGCTGCAGACAGCTGTTTACTAATGAGTGGGGCTGGGGTAAGACCTACTGTCAATCCCTGCAACCTTTCTATGAAAGAAAAGTCTTTGGTAACT

TAAGAGGCTACCTAGTGGAAGAACAGGACATAACTTCCATTTGTCACTCCCTCCCTGTTTGCCTACTTCCTGCTAGTTAGCTCACACCTGATGTTGTAGA

CAGTTTACTGTTTCTTTTTCTAGGACAGGCAAATAGATAGCTTAGATAGCTTCCTGTTCTCTCTGGCCCCTTCTTACTCCTACCACCAAGAATTTACCCA

TGATGGCAACTTTGTTCAGTGTGAAGAAGCCAGCATGTTCAGCTGAGCCTTTGAAGGCTACCCTGGGTTCTTGTGGGTCTGTATGTGGCCTGAGATTGCT

AAAAGCCAAATTATCTTACCTTTGAACCCTTCTACCCTCTTGCAAATGGAATGCTGAAGCCAGCTTGTTCAATAGATCAACAGCATCCAGTACCAAATAG

GATCTCATTTTTATTGCTTGGATTTTCCAGGGTATATTGGAGACACTGGCCAAACTCATGGCCTTCTGCTGGTGTCACTGCCACCATCTTCATCAAGAGC

CATCATTCACTGAGTTGCTGCTGTGTTGGTGGCCTGGGAGGGGCCTGAGACCTTACATTTGAGTTCATCCTGAACTCAGTCACTCATCAGGAGGCCCATG

TGGTTCTTGTGAAGCTCAGACCTGAGGTGAGAGGCTCCAGTGCTGACTGCATAGTACTCCACTAGGCATATACCAACTCTGTTTTTAATAGTCTATTTTT

GTGCTAAATGGGCTTTGTACTGTACTTGCTCCAGTCTGCTGAGCACTAGGTTACTAGAGAACATTTGGCCCTGTGTAAGTGTGCCTTTCATACATAGCTT

TATGGTTTTAAGTAGTCCCCAGTTTTACTGGGGTTTAGTCATTGGAGTAAATTTTTGAAAAATGCAATTGACAACTGAAGAATCATTAAGGAAGATGATG

GCCCAGCTGGATTTAATTACACCAAAGATCATAAGGAAACATCCTTGAGATCTTGGTGATTCTCTTCCTGAGGGCAGCCTCTCCTCTAATGACTCAGCCT

ATTCCTAACAGTCAGGTCAGTAGTGTTGCCAGCTGCCTGCTCGCCAATACCACTGAAGCACTATGAGACTTCACCCACCTTGAGACAGAGTGGCCCTCCG

TGTCTGAGTGGACTTTGAGAGTATTGCTGACTGAAGTACCCAGGATTCTAGCTAGTCCTAGACCAAGAGCAGGCAAAGGAATTCTCAAACAGGAATCTGG

AACTGAAAATTTCCATATGGTTTTGGAGGTAGAAATGAAGAGCCATATATAAACAAAGATGTTATTTCTGAACAATTTCAATTGCCCCCCCCCCCAGGTA

ATCAAACCACTCCTGGCCCAAAAAGAAGGAAATCGTGTAGATATGGTTTGATGATCATAGGGTTTTGTTTTTAAACTCAAACTCAGTGGTTCAACCTGTG

AGAATTCTTTAAACTGAGAAAAAAACATTCTTGGCTCACAGGTTTTGGAAAAGGAGGCAGAGAGGAGAGACATCTTTGACTCCTCAGAACCAGGGAGTGC

AATACAAAGACTATTGAGTGCTGCTCACATTTACAAAAACGAACACTACTTGGTAGAATCTTAGCACACTTTCCTTGTCTCATTTCATTTCTTCTGAGGA

AACAGGAAAGTTAATTCATAATTTCCTTTTCCCTCTCAAGCACTTTTTAAATTTCCAGAGACCTCTGATCAAGGGTCATTTTTAGAGCCTTTTGATGTGT

GTTTAATCTCACTCAATGTTCTTTTGGTGACTGCAGTGATACTGAGCCTCCGTGGGAAGGCTTAACAGTTAGAGTGCACTTTAATTCATTAATTCACGAT

CCATGTGGCCTTATAATAATGGGTCAAGGAACCCATTTCATTCTTGCCTGCCAAAGAGTTACACAGAAGCACATCAAACACCAGCACTTCACCTGCACGA

AGGGATGAGACTGGGATCCCTGAGTAAACTTCTTTAATAGTGTGTGCTATGCCATTTGGAAATGTTTTTTAACCTCAGGTTTTAAATAAAGCAAATACTG

TGGC
Translation
  MASSSTETQLQRIIRDLQD DAATELSHEFKEGGEPITDDSTSLHKFSYKLEYLLQ FDQKEKASLLGSKKDYWDYFCACLAKVKGANDGIRFVRSIS

E LRTSLGKGRAFIRYSLVHQRLADTLQQCFMNTKVTS SDWYYARSPFLKPKLSSDIVGQLYELTEVQFDLAPRGYDLDAAWPTFAR RRTLATSTSAY

MWKPPSRSSSMSSLVSNYLQ TQEMASSLDLNCSLNNEALESFDEMRLELDQLEVREKQLQERVQQLDRENQALRMLVSRQGGQLQVEKEMGYLAVEDSI

GLVSLVAELQKQGDVSQATVKKLQSCLQALELNVDKKEYSPSALQLENMAKELDTVRGSLGRENQLLASLSERLARAEKGEKTPPDTELHQEPVPADLVL

KFQELKGKLQALEGENTEAQELNRQQSIKLEQLAKELQLKEEARASLAHLVKDVVPLQEELSGKKQESAQLRRQLQESLAHLSSVEEELAEARQQEKQHR

EEKQLLEQEATSLTWQLQLLETQLGQVSQLVSDLEEQKKQLMQERDHLSQRVGTLEQLAEVHGPPQSAEMPEKRQQCLREEQVNNSTVSEAEQEELQKEL

QNMVDRNQLLEGKLQALQTDYKALQQREAAIQGSLASLEAEQASIRHLGNQMEASLLAVKKAKETMKAQVAEKEAALQSKESECQRLQEEADQCRLQAEA

QAQELRALENQCQQQIQLIEVLSAEKGQQGLSLPQVNTDQLALSQAQLEIHQGEAQRLQNEVVDLQAKLQVALGDRDKLQSQLGVAETVLREHKTLVQQL

KEQNEALNRAHVQELLQCSEREGILQEESIYKAQKQEQELRALQAELSQVRCSSEGAHLEHAELQDQLHRANTDTAELGIQVCALTAEKDRMEEALASLA

QELQDSKEAALQERKGLELQVMQLQQEKEKLQEKVKAAEEAASSFSGLQAQLAQAEQLAQSLQETAHQEQDALKFQLSAEIMDHQNRLK TANEECGHLR

AQLEEQGQQLQMTKEAVQELE ITKAAMEEKLNCTSSHLAECQATLLRKDEESTMLQTSLER - UNI34393 - RTQKELEKATSKIQEYYNKLCQEV

TNRERNDQKMLADLDDLNRTKKYLEERLIELLR - UNI34393 - RDKDALWQKSDALEEFQQKLSAEEKCLGDMEVNHCHDCKREFSWIVRRHHCR 

- UNI34393 - RICGRIFCYYCCNNYVVTKPSGKKERCCRACFQKFGEGSGSNDSSGSGTSQGEPSPMVSPAEASPQSIGSQG GINSVCRPPDDAVF

DIITDEELCQIQESGSSLPETPTETDSMDPNTAEQ QDTTSNSLTPEDTEDVPMGQDAEICLLKSGELM MIKLPLTVEEVASFGEGSRELFVRSSTYSL

ITITVAEPGLTISWVFSSDPKSISFSVVFQETEDTPLDQCK VLIPTTRCNSHKENIRGQLKVRIPGIYLLIFDNTFSR RFISKKVLYHLTVDRPVIYD

GSDFP

For any suggestions or comments, please send an email to unitrap@crg.es