Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025316 (Banp)
Chromosomal location
Chr 8: 124474447 - 124549969 (+)
Description
BTG3 associated nuclear protein Gene [Source:MGI Symbol;Acc:MGI:1889023]
RefSeq_dna
NM_016812 
RefSeq_peptide
NP_058092.2 NP_001103570.1 
UniGene
Mm.287163 
MGI
MGI:1889023 
Uniprot/SWISSPROT
Q8VBU8 
Human Ortholog
ENSG00000172530 (BANP)
Omim not available
UniTrap UNI1163
Vector Insertion
Chr 8: 124474549 - 124498326
Public Clones AZ0212 (sanger) (sanger) XT0384 (sanger) CD0121 (sanger) XI250 (baygenomics)
XL817 (baygenomics) P126D08 (ggtc) P138D01 (ggtc) D018B03 (ggtc)
P014E12 (ggtc) D143E12 (ggtc) D040H01 (ggtc) D044B08 (ggtc) P144E11 (ggtc)
D088D01 (ggtc) A20018 (ggtc) PST7022-NR (escells) PST14168-NR (escells)
PST7216-NR (escells) PST4695-NR (escells) IST14631E5 (tigm) IST14395H1 (tigm)
IST14929F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21703
Vector Insertion
Chr 8: 124498326 - 124498466
Public Clones not available
Private Clones OST320541 (lexicon) OST310103 (lexicon) OST266002 (lexicon) OST259187 (lexicon)
OST250307 (lexicon) OST237060 (lexicon) OST219896 (lexicon) OST216750 (lexicon)
OST206827 (lexicon) OST194082 (lexicon) OST45271 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12408
Vector Insertion
Chr 8: 124498466 - 124499799
Public Clones A011A02 (ggtc) A010E08 (ggtc) W121D01 (ggtc)
Private Clones OST220609 (lexicon) OST209037 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2574
Vector Insertion
Chr 8: 124499799 - 124499892
Public Clones XS0191 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23372
Vector Insertion
Chr 8: 124499892 - 124502454
Public Clones (ggtc) IST10823C3 (tigm)
Private Clones OST261889 (lexicon) OST257771 (lexicon) OST223703 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7355
Vector Insertion
Chr 8: 124502655 - 124513854
Public Clones RRU300 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12214
Vector Insertion
Chr 8: 124515427 - 124515604
Public Clones A052A01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7874
Vector Insertion
Chr 8: 124520939 - 124521180
Public Clones RRJ029 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20555
Vector Insertion
Chr 8: 124544545 - 124547902
Public Clones not available
Private Clones OST358869 (lexicon)
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000076274
Sequence
GGCGCTCGCGGCGCCTGCGCAGAGCGGCTGCTTCTCTCGCGAGGACGGACGCCATTATCGCAGCTCCCCGACAAACACCACGAGAATTCCGCAGCCCACA

CG - UNI1163 - - UNI21703 - GTGACAGAAACCGCATACCCTGTGACTTCTGGACTCTTGCTGTCAGTGTGCCCCTTCCTCGTGCTCTGGATG

ATGTCAGAGCAGGACCTGGCGGATGTGGTTCAGATTGCAGTGGAAGACCTGAGCCCTGATCACCCAG - UNI2574 - - UNI12408 - - UNI21

703 - TTGTTTTGGAGAATCATGTCGTGACAGATGATGATGAACCTGCCTTGAAGCGCCAGCGACTAGAGATCAATTGCCAGGACCCCTCTATAAAG -

 UNI2574 - - UNI23372 - TCTTTCCTGTACTCTATTAACCAGACGATATGTTTGCGGTTGGATAGCATTGAGGCCAAGCTGCAAGCTCTCGAGG

CCACTTGCAAATCTCTGGAAGAGAAGCTAGACCTGGTCACCAATAAACAGCACAGTCCCATCCAGGTCCCCATGGTGGCAGGTTCCCCACTTGGCGCCAC

CCAGACCTGCAACAAAGTGCGATG - UNI7355 - CGTCGTCCCCCAGACTACAGTAATACTCAACAATGATCGGCAGAACGCCATTGTAGCCAAGAT

GGAAGACCCATTGAGCAACAGGGCACCGGATTCCCTGGAAAATATCATTAGCAA - UNI12214 - CGCTGTTCCTGGGCGTCGGCAGAACACCATCG

TGGTGAAAGTGCCTGGTCAGGACGACAGCCACAACGAAGATGGGGAGAGCGGGTCAGAGGCCAGTGACTCCGTGTCTAACTGTGGCCAGCCAGGAAGCCA

GAACATTGGAAGCAACGTCACACTCATCACCCTGAACTCCGAAG - UNI7874 - - UNI12214 - AGGACTATCCCAATGGCACCTGGCTGGGCG

ATGAGAATAACCCTGAGATGCGGGTACGCTGTGCCATCATCCCTTCCGACATGTTGCACATCAGCACCAACTGTCGCACGGCCGAGAAGATGGCGCTGAC

ACTGCTGGACTACCTGTTCCACCGTGAGGTGCAGGCTGTGTCCAACTTGTCCGGCCAGGGCAAGCACGGGAAGAAGCAGCTGGACCCCCTCACCATCTAC

GGCATCCGGT - UNI7874 - GTCACCTCTTCTATAAATTTGGAATCACGGAATCTGACTGGTATCGGATCAAGCAGAGCATTGACTCCAAGTGCCGG

ACAGCCTGGCGGCGGAAGCAGCGAGGCCAGAGCCTGGCGGTCAAGAGCTTCTCTCGGAGGACGCCATCCTCATCCTCTTACAGTGCCTCAG AGACCATG

ATGGGAACCCCTCCTCCCACCAGTGAGCTACAGCAGTCACAGCCACAGGCCCTACACTACGCCCTGGCCAACGCCCAGCAGGTCCAGATCCACCAGATTG

GGGAGGATGGACAGGTGCAAGTA ATCCCACAGGGCCACCTCCACATTGCCCAGGTGCCTCAAGGGGAGCAGGTGCAGATCACACAGGACAGCGAG GGC

AATCTGCAGATCCATCATGTGGGTCAGGATGGCCAG - UNI20555 - GTACTGCAGGGTGCTCAGCTCATAGCCGTGGCCTCTTCAGACCCTGCTGC

TACAGGAGTAGATGGGTCGCCTCTCCAGGGCAGTGACATTCAGGTTCAGTATGTCCAGCTGGCGCCTGTGAGTGACCACACAGCCGCAGCGCAG ACCGC

AGAGGCCCTGCAGCCCACTCTGCAGCCCGACATGCAGCTTGAACATGGGGCCATCCAGATCCAGTGAGGCCAGGCACTGCAGGAGCACCGCGTCACAGCT

GCTCGCTGACCCTGCCCCACTCGTGCCCTGCTCTCTTGCTTCAGCAAGCAACTGCAGGTTCTGCTGGGCATCTGAGAGCTGCTCCTCCCAGGGGAAGGTC

CTGGCCACCCCTGCTGGAAGGCGCCTCAGGGTTGGAGTCTCACTACTGGTCGTCTCCAAAGGAGAAGCATAGTGCAGAGTGTTGAGTGCATTCAGACAGA

CAAGAACTACGATATTTTGTTTAAACAGCTTTTTTAATTTGCTATGGTGTTTATAACAAAAAAGAAAATGGAAAAAAAAAAAAAAACAAAAACATCCAAC

CAACCAACCAACCAACCAAACCAGAGGAGAAACACAACTGTGGAGTAGTGAAAGCCTGGGCCGTGTGCTCCCCTTCGGGGTTCTGACGTAGGTGTTGGAG

C
Translation
 - UNI1163 - - UNI21703 -  - UNI2574 - - UNI12408 - - UNI21703 -  - UNI2574 - - UNI23372 -  - UNI735

5 -  - UNI12214 -  - UNI7874 - - UNI12214 - MALTLLDYLFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRC - UNI7874 - CH

LFYKFGITESDWYRIKQSIDSKCRTAWRRKQRGQSLAVKSFSRRTPSSSSYSASE ETMMGTPPPTSELQQSQPQALHYALANAQQVQIHQIGEDGQVQV

 IPQGHLHIAQVPQGEQVQITQDSE GNLQIHHVGQDGQ - UNI20555 - VLQGAQLIAVASSDPAATGVDGSPLQGSDIQVQYVQLAPVSDHTAAA

Q TAEALQPTLQPDMQLEHGAIQIQ
Transcript ENSMUST00000093078
Sequence
GGCGCTCGCGGCGCCTGCGCAGAGCGGCTGCTTCTCTCGCGAGGACGGACGCCATTATCGCAGCTCCCCGACAAACACCACGAGAATTCCGCAGCCCACA

CG - UNI1163 - - UNI21703 - GTGACAGAAACCGCATACCCTGTGACTTCTGGACTCTTGCTGTCAGTGTGCCCCTTCCTCGTGCTCTGGATG

ATGTCAGAGCAGGACCTGGCGGATGTGGTTCAGATTGCAGTGGAAGACCTGAGCCCTGATCACCCAG - UNI2574 - - UNI12408 - - UNI21

703 - TTGTTTTGGAGAATCATGTCGTGACAGATGATGATGAACCTGCCTTGAAGCGCCAGCGACTAGAGATCAATTGCCAGGACCCCTCTATAAAG -

 UNI2574 - - UNI23372 - TCTTTCCTGTACTCTATTAACCAGACGATATGTTTGCGGTTGGATAGCATTGAGGCCAAGCTGCAAGCTCTCGAGG

CCACTTGCAAATCTCTGGAAGAGAAGCTAGACCTGGTCACCAATAAACAGCACAGTCCCATCCAGGTCCCCATGGTGGCAGGTTCCCCACTTGGCGCCAC

CCAGACCTGCAACAAAGTGCGATG - UNI7355 - - UNI12214 - CGCTGTTCCTGGGCGTCGGCAGAACACCATCGTGGTGAAAGTGCCTGGTC

AGGACGACAGCCACAACGAAGATGGGGAGAGCGGGTCAGAGGCCAGTGACTCCGTGTCTAACTGTGGCCAGCCAGGAAGCCAGAACATTGGAAGCAACGT

CACACTCATCACCCTGAACTCCGAAG - UNI7874 - - UNI12214 - AGGACTATCCCAATGGCACCTGGCTGGGCGATGAGAATAACCCTGAGA

TGCGGGTACGCTGTGCCATCATCCCTTCCGACATGTTGCACATCAGCACCAACTGTCGCACGGCCGAGAAGATGGCGCTGACACTGCTGGACTACCTGTT

CCACCGTGAGGTGCAGGCTGTGTCCAACTTGTCCGGCCAGGGCAAGCACGGGAAGAAGCAGCTGGACCCCCTCACCATCTACGGCATCCGGT - UNI78

74 - GTCACCTCTTCTATAAATTTGGAATCACGGAATCTGACTGGTATCGGATCAAGCAGAGCATTGACTCCAAGTGCCGGACAGCCTGGCGGCGGAAG

CAGCGAGGCCAGAGCCTGGCGGTCAAGAGCTTCTCTCGGAGGACGCCATCCTCATCCTCTTACAGTGCCTCAG AGACCATGATGGGAACCCCTCCTCCC

ACCAGTGAGCTACAGCAGTCACAGCCACAGGCCCTACACTACGCCCTGGCCAACGCCCAGCAGGTCCAGATCCACCAGATTGGGGAGGATGGACAGGTGC

AAGTA ATCCCACAGGGCCACCTCCACATTGCCCAGGTGCCTCAAGGGGAGCAGGTGCAGATCACACAGGACAGCGAG GGCAATCTGCAGATCCATCAT

GTGGGTCAGGATGGCCAG TCGTGGGGCCTGTGCCAGAATCCCATTCCTGTCAGCGGTGACTCAGTGGCCCAGGCTAATCCCTCCCAGCTTTGGCCTCTG

GGAGGAGACACACTTGATCTGCCTGCTGGAAATGAAATGATCCAG - UNI20555 - GTACTGCAGGGTGCTCAGCTCATAGCCGTGGCCTCTTCAGA

CCCTGCTGCTACAGGAGTAGATGGGTCGCCTCTCCAGGGCAGTGACATTCAGGTTCAGTATGTCCAGCTGGCGCCTGTGAGTGACCACACAGCCGCAGCG

CAG ACCGCAGAGGCCCTGCAGCCCACTCTGCAGCCCGACATGCAGCTTGAACATGGGGCCATCCAGATCCAGTGAGGCCAGGCACTGCAGGAGCACCGC

GTCACAGCTGCTCGCTGACCCTGCCCCACTCGTGCCCTGCTCTCTTGCTTCAGCAAGCAACTGCAGGTTCTGCTGGGCATCTGAGAGCTGCTCCTCCCAG

GGGAAGGTCCTGGCCACCCCTGCTGGAAGGCGCCTCAGGGTTGGAGTCTCACTACTGGTCGTCTCCAAAGGAGAAGCATAGTGCAGAGTGTTGAGTGCAT

TCAGACAGACAAGAACTACGATATTTTGTTTAAACAGCTTTTTTAATTTGCTATGGTGTTTATAACAAAAAAGAAAATGGAAAAAAAAAAAAAAACAAAA

ACATCCAACCAACCAACCAACCAACCAAACCAGAGGAGAAACACAACTGTGGAGTAGTGAAAGCCTGGGCCGTGTGCTCCCCTTCGGGGTTCTGACGTAG

GTGTTGGAGC
Translation
 - UNI1163 - - UNI21703 - MMSEQDLADVVQIAVEDLSPDHPV - UNI2574 - - UNI12408 - - UNI21703 - VVLENHVVTDD

DEPALKRQRLEINCQDPSIK - UNI2574 - - UNI23372 - SFLYSINQTICLRLDSIEAKLQALEATCKSLEEKLDLVTNKQHSPIQVPMVAGS

PLGATQTCNKVRC - UNI7355 - - UNI12214 - CAVPGRRQNTIVVKVPGQDDSHNEDGESGSEASDSVSNCGQPGSQNIGSNVTLITLNSEE 

- UNI7874 - - UNI12214 - EDYPNGTWLGDENNPEMRVRCAIIPSDMLHISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQLDPLT

IYGIRC - UNI7874 - CHLFYKFGITESDWYRIKQSIDSKCRTAWRRKQRGQSLAVKSFSRRTPSSSSYSASE ETMMGTPPPTSELQQSQPQALHY

ALANAQQVQIHQIGEDGQVQV IPQGHLHIAQVPQGEQVQITQDSE GNLQIHHVGQDGQ SWGLCQNPIPVSGDSVAQANPSQLWPLGGDTLDLPAGNE

MIQ - UNI20555 - VLQGAQLIAVASSDPAATGVDGSPLQGSDIQVQYVQLAPVSDHTAAAQ TAEALQPTLQPDMQLEHGAIQIQ
Transcript ENSMUST00000026354
Sequence
GGCGCTCGCGGCGCCTGCGCAGAGCGGCTGCTTCTCTCGCGAGGACGGACGCCATTATCGCAGCTCCCCGACAAACACCACGAGAATTCCGCAGCCCACA

CG - UNI1163 - - UNI21703 - GTGACAGAAACCGCATACCCTGTGACTTCTGGACTCTTGCTGTCAGTGTGCCCCTTCCTCGTGCTCTGGATG

ATGTCAGAGCAGGACCTGGCGGATGTGGTTCAGATTGCAGTGGAAGACCTGAGCCCTGATCACCCAG - UNI2574 - - UNI12408 - - UNI21

703 - TTGTTTTGGAGAATCATGTCGTGACAGATGATGATGAACCTGCCTTGAAGCGCCAGCGACTAGAGATCAATTGCCAGGACCCCTCTATAAAG -

 UNI2574 - - UNI23372 - TCTTTCCTGTACTCTATTAACCAGACGATATGTTTGCGGTTGGATAGCATTGAGGCCAAGCTGCAAGCTCTCGAGG

CCACTTGCAAATCTCTGGAAGAGAAGCTAGACCTGGTCACCAATAAACAGCACAGTCCCATCCAGGTCCCCATGGTGGCAGGTTCCCCACTTGGCGCCAC

CCAGACCTGCAACAAAGTGCGATG - UNI7355 - CGTCGTCCCCCAGACTACAGTAATACTCAACAATGATCGGCAGAACGCCATTGTAGCCAAGAT

GGAAGACCCATTGAGCAACAGGGCACCGGATTCCCTGGAAAATATCATTAGCAA - UNI12214 - CGCTGTTCCTGGGCGTCGGCAGAACACCATCG

TGGTGAAAGTGCCTGGTCAGGACGACAGCCACAACGAAGATGGGGAGAGCGGGTCAGAGGCCAGTGACTCCGTGTCTAACTGTGGCCAGCCAGGAAGCCA

GAACATTGGAAGCAACGTCACACTCATCACCCTGAACTCCGAAG - UNI7874 - - UNI12214 - AGGACTATCCCAATGGCACCTGGCTGGGCG

ATGAGAATAACCCTGAGATGCGGGTACGCTGTGCCATCATCCCTTCCGACATGTTGCACATCAGCACCAACTGTCGCACGGCCGAGAAGATGGCGCTGAC

ACTGCTGGACTACCTGTTCCACCGTGAGGTGCAGGCTGTGTCCAACTTGTCCGGCCAGGGCAAGCACGGGAAGAAGCAGCTGGACCCCCTCACCATCTAC

GGCATCCGGT - UNI7874 - GTCACCTCTTCTATAAATTTGGAATCACGGAATCTGACTGGTATCGGATCAAGCAGAGCATTGACTCCAAGTGCCGG

ACAGCCTGGCGGCGGAAGCAGCGAGGCCAGAGCCTGGCGGTCAAGAGCTTCTCTCGGAGGACGCCATCCTCATCCTCTTACAGTGCCTCAG AGACCATG

ATGGGAACCCCTCCTCCCACCAGTGAGCTACAGCAGTCACAGCCACAGGCCCTACACTACGCCCTGGCCAACGCCCAGCAGGTCCAGATCCACCAGATTG

GGGAGGATGGACAGGTGCAAGTA ATCCCACAGGGCCACCTCCACATTGCCCAGGTGCCTCAAGGGGAGCAGGTGCAGATCACACAGGACAGCGAG GGC

AATCTGCAGATCCATCATGTGGGTCAGGATGGCCAG TCGTGGGGCCTGTGCCAGAATCCCATTCCTGTCAGCGGTGACTCAGTGGCCCAGGCTAATCCC

TCCCAGCTTTGGCCTCTGGGAGGAGACACACTTGATCTGCCTGCTGGAAATGAAATGATCCAG - UNI20555 - GTACTGCAGGGTGCTCAGCTCAT

AGCCGTGGCCTCTTCAGACCCTGCTGCTACAGGAGTAGATGGGTCGCCTCTCCAGGGCAGTGACATTCAGGTTCAGTATGTCCAGCTGGCGCCTGTGAGT

GACCACACAGCCGCAGCGCAG ACCGCAGAGGCCCTGCAGCCCACTCTGCAGCCCGACATGCAGCTTGAACATGGGGCCATCCAGATCCAGTGAGGCCAG

GCACTGCAGGAGCACCGCGTCACAGCTGCTCGCTGACCCTGCCCCACTCGTGCCCTGCTCTCTTGCTTCAGCAAGCAACTGCAGGTTCTGCTGGGCATCT

GAGAGCTGCTCCTCCCAGGGGAAGGTCCTGGCCACCCCTGCTGGAAGGCGCCTCAGGGTTGGAGTCTCACTACTGGTCGTCTCCAAAGGAGAAGCATAGT

GCAGAGTGTTGAGTGCATTCAGACAGACAAGAACTACGATATTTTGTTTAAACAGCTTTTTTAATTTGCTATGGTGTTTATAACAAAAAAGAAAATGGAA

AAAAAAAAAAAAACAAAAACATCCAACCAACCAACCAACCAACCAAACCAGAGGAGAAACACAACTGTGGAGTAGTGAAAGCCTGGGCCGTGTGCTCCCC

TTCGGGGTTCTGACGTAGGTGTTGGAGC
Translation
 - UNI1163 - - UNI21703 - MMSEQDLADVVQIAVEDLSPDHPV - UNI2574 - - UNI12408 - - UNI21703 - VVLENHVVTDD

DEPALKRQRLEINCQDPSIK - UNI2574 - - UNI23372 - SFLYSINQTICLRLDSIEAKLQALEATCKSLEEKLDLVTNKQHSPIQVPMVAGS

PLGATQTCNKVRC - UNI7355 - CVVPQTTVILNNDRQNAIVAKMEDPLSNRAPDSLENIISN - UNI12214 - NAVPGRRQNTIVVKVPGQDD

SHNEDGESGSEASDSVSNCGQPGSQNIGSNVTLITLNSEE - UNI7874 - - UNI12214 - EDYPNGTWLGDENNPEMRVRCAIIPSDMLHISTN

CRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRC - UNI7874 - CHLFYKFGITESDWYRIKQSIDSKCRTAWRRKQRGQSLAV

KSFSRRTPSSSSYSASE ETMMGTPPPTSELQQSQPQALHYALANAQQVQIHQIGEDGQVQV IPQGHLHIAQVPQGEQVQITQDSE GNLQIHHVGQDG

Q SWGLCQNPIPVSGDSVAQANPSQLWPLGGDTLDLPAGNEMIQ - UNI20555 - VLQGAQLIAVASSDPAATGVDGSPLQGSDIQVQYVQLAPVSD

HTAAAQ TAEALQPTLQPDMQLEHGAIQIQ

For any suggestions or comments, please send an email to unitrap@crg.es