Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025340 (Rabgef1)
Chromosomal location
Chr 5: 130647668 - 130690212 (+)
Description
RAB guanine nucleotide exchange factor (GEF) 1 Gene [Source:MGI (curated);Acc:Rabgef1-001]
RefSeq_dna
NM_019983 
RefSeq_peptide
NP_064367.1 
UniGene
Mm.288639 Mm.474835 
MGI
MGI:1929459 
Uniprot/SWISSPROT
Q9JM13 
Human Ortholog
ENSG00000154710 (RABGEF1)
Omim not available
UniTrap UNI7750
Vector Insertion
Chr 5: 130647765 - 130663049
Public Clones RRN124 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31250
Vector Insertion
Chr 5: 130647765 - 130663270
Public Clones IST14511H6 (tigm) IST14742B6 (tigm) IST14708E2 (tigm) IST14168C2 (tigm)
IST14971B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16716
Vector Insertion
Chr 5: 130663030 - 130663457
Public Clones not available
Private Clones OST455573 (lexicon) OST321837 (lexicon) OST298184 (lexicon) OST268908 (lexicon)
OST222140 (lexicon) OST185754 (lexicon) OST180277 (lexicon) OST171492 (lexicon)
OST167560 (lexicon) OST166422 (lexicon) OST147176 (lexicon) OST147174 (lexicon)
OST130010 (lexicon) OST128184 (lexicon) OST94722 (lexicon) OST59558 (lexicon)
OST57470 (lexicon) OST53090 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21855
Vector Insertion
Chr 5: 130663457 - 130666746
Public Clones (sanger)
Private Clones OST315538 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34133
Vector Insertion
Chr 5: 130666914 - 130673816
Public Clones IST14898H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7437
Vector Insertion
Chr 5: 130673819 - 130673987
Public Clones RRS789 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000026390
Sequence
GCTCTGTGAATTTCAGACCTCAGATGAAGTCGTTCTTTACTATGACTCTACTTGAATTTGCGTGTTTAACTTTGGTTTTTCTACTTTCTTCTCTCCTTCT

GTTCTTTCTCCCCTATGGCTTGAAGATCTCAGACTCATTTGTATTTTGCTTTATAAATGTTGTATTTTAATAGTATGGAAGTAAATTAATTTTCAGTGCT

TTTTCACTCCTTGGTTATCAGGAAGAAGATGAGCCTGAAGTCCGAACGCAGGGGAATTCATGTGGATCAATCTGAGCTCCTGTGCAAGAAAGGATGCGGT

TACTACGGCAACCCTGCCTGGCAGGGTTTCTGCTCCAAGTGCTGGAGGGAGGAGTACCACAAGGCCCGGCAGAGGCAGATCCAAGAGGACTGGGAACTGG

CAGAACG - UNI16716 - - UNI21855 - ACTTCAGCGGGAGGAGGAAGAGGCCTTCGCGAGCAGCCAGAGCAGCCAAGGAGCCCAGTCCCTCAC

CTTCTCCAAGTTCGAGGAGAAGAAGACCAATGAGAAAACCCGAAAAGTCACCACAGTGAAGAAGTTCTTCAGCGCCTCTTCCAGAGCTGGATCCAAGAAG

G - UNI7437 - - UNI34133 - AAATTCAGGAAGCCAAAGCTCCCAGTCCCTCCATAAACCGGCAAACCAGCATTGAGACGGACCGAGTGACTAA

GGAGTTCATAGACTTTCTCAAGACCTTCCACAAGACAGGCCAAGAAGTCTATAAACAGACGAAGATGTTTTTGGAAGCAATGCCTTATAAAAGG - UNI

7437 - GATTTAAGCATCGAGGAACAGTCAGAATGTACTCAGGACTTTTACCAAAATGTGGCTGAAAGAATGCAGACCCGTGGGAAAG TGCCTCCAGA

GAAAGTGGAGAAGATAATGGATCAGATCGAAAAGCACATCATGACGCGTCTCTATAAATTTGTGTTCTGCCCAGAGACTACTGATGATGAGAAGAAAGAT

CTCGCCATTCAAAAAAGAATCAG GGCCCTGCACTGGGTAACGCCTCAGATGCTCTGTGTCCCTGTCAATGAGGAAATCCCTGAAGTGTCCGACATGGTG

GTGAAAGCGATCACAG ACATCATTGAGATGGACTCAAAGCGTGTGCCTCGGGACAAGCTGGCCTGCATCACCAGGTGCAGCAAGCACATCTTCAATGCC

ATCAAGATCACCAAGAATGAGCCAGCCTCTGCCGATGACTTCCTGCCCACCCTGATCTACATCGTCCTGAAGGGCAACCCCCCTCGCCTGCAGTCCAACA

TCCAGTACATCACTCGCTTCTGCAACCCCAGCCGGCTCATGACGGGCGAGGATGGCTACTACTTCACCAACCTG TGCTGTGCTGTGGCTTTCATTGAGA

AATTAGACGCCCAGTCTTTGAATTTAAGTCAGGAGGATTTTGACCGGTACATGTCTGGCCAGACATCCCCCAGGAAGCAGGAGTCTGAGAGTTGGCCCCC

GGAGGCCTGCTTAGGTGTGAAGCAAATGTATAAGAACTTGGACCTCCTGTCTCAGTTGAATGAACGGCAAGAAAGGATCATGAACGAAGCCAAGAAACTT

GAAAAAGACTTAATAGACTGGACAGACGGGATTGCCAAGGAAGTTCAAGACATTGTTGAGAAATACCCACTGGAGATTAAGCCCCCGAACCAACCCTTAG

CAGCCATCGACTCTGAGAATGTGGAGAACGACAAGCTCCCTCCCCCTCTGCAGCCTCAGGTGTACGCAGGGTGACGGCCCTGTTTATTTGGGGCTGGTTT

CTGGGAGCTGCTGCGTTCCACTGTTCAGGTCCGGAATATGAACTGACTGCTTAAAGTTTCAAAGTGTTTTTAGGTACAGATTTAGGGATTGGTTATTCTC

TTTTTTCTTCTCTAGCGGGGAAGCTTAGTAAATAATAATGTACTATTTATTTGAGCTGGTGGAGTAGGTTTGTGTGAATTCTGTGTCGCTCTTTTATGTC

CTGCCTGATTTCCCATGGGCTTCCTCTGTGTAGACACTGTTGTTGGTTTTGGGCAAACACTGCCTTTTAAAGGATAAAACAGATGCTATAAAGTCTATGT

TGAAATGAATTCTATGTTCCCACACTCCCCCAGTGTGAAATAATTTTGTAATTGTAAAGATAGAAGATAATGTTAATAAGTAAATATGTAAAATTGTAAA

TATGTAAAAAAAAAACACATAGGGCTGGGGAGGGGTGTCTCAGCGTGCATGGCATTTCATGAGCTGATGTTTTTTTTTTTTTTTTAGGTGAAAATGAAAT

TTATTGAATGTTTGCCTTTAGCGCCATTTTATATGGTTTGTCCCACTAAAAAGAATCTAAAGAATTTGAGCTTTAACAGGACATTGGCACTAACTGCCCT

AACTTGAGATTCTTTCTGGTACATGTGAAGAAGTTGTAACGCCAACTTTTAGGTCACATACAGAATTATTCTGGGACCCTGGGGTGGTGGCTCAGTCAGT

AAAGTGCTCTCCATACTGATGTGAGGACCTGAGCTCCCTGTCCGGCCCCGGGTGAAAAGCTGGGCATGGTGACACTCACTTGGGACAGCTCTGCTGGGAG

CCAGAGTTCCTGGGGCAGGGGGCATCGCTGTCAATGAGACACCTCGTGTAAGCAAACAAATCAAGATGGACGGCTCCTGAGAAATGATAGCCAAGGATGC

CCTCTGGCCTCCACATGGCCACATATGTGCCTGTGTACCTCTACATACATGTGTAGCACACACACATGAACACACAGTTGCTGATTAGTACAGTTGACTT

GGAACTGTGCTTGCAGCTTCCTTTCCCTGTTTATCCAATAAACTTCCCCCACAGTGCTGTGGGGCTATTGCCTTTTTT
Translation
MSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKARQRQIQEDWELAER - UNI16716 - - UNI21855 - RLQREEEEAFASS

QSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRAGSKKE - UNI7437 - - UNI34133 - EIQEAKAPSPSINRQTSIETDRVTKEFIDF

LKTFHKTGQEVYKQTKMFLEAMPYKR - UNI7437 - DLSIEEQSECTQDFYQNVAERMQTRGKV VPPEKVEKIMDQIEKHIMTRLYKFVFCPETTD

DEKKDLAIQKRIR RALHWVTPQMLCVPVNEEIPEVSDMVVKAITD DIIEMDSKRVPRDKLACITRCSKHIFNAIKITKNEPASADDFLPTLIYIVLKG

NPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNL CCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQESESWPPEACLGVKQMYKNLDLLSQLNERQE

RIMNEAKKLEKDLIDWTDGIAKEVQDIVEKYPLEIKPPNQPLAAIDSENVENDKLPPPLQPQVYAG
Transcript ENSMUST00000119797
Sequence
GGGGGCGGGGCGTGCGGGGGCAGGGGCGGGGCAGGGAGCCGAGTGACTGAAGGGGCGCTGGGAGCGGCGGTCGGACGCCGGCGGAGCCGCGGAGCAG - 

UNI7750 - - UNI16716 - - UNI31250 - GAAGAAGATGAGCCTGAAGTCCGAACGCAGGGGAATTCATGTGGATCAATCTGAGCTCCTGTGC

AAGAAAGGATGCGGTTACTACGGCAACCCTGCCTGGCAGGGTTTCTGCTCCAAGTGCTGGAGGGAGGAGTACCACAAGGCCCGGCAGAGGCAGATCCAAG

AGGACTGGGAACTGGCAGAACG - UNI16716 - - UNI21855 - ACTTCAGCGGGAGGAGGAAGAGGCCTTCGCGAGCAGCCAGAGCAGCCAAGG

AGCCCAGTCCCTCACCTTCTCCAAGTTCGAGGAGAAGAAGACCAATGAGAAAACCCGAAAAGTCACCACAGTGAAGAAGTTCTTCAGCGCCTCTTCCAGA

GCTGGATCCAAGAAGG - UNI7437 - - UNI34133 - AAATTCAGGAAGCCAAAGCTCCCAGTCCCTCCATAAACCGGCAAACCAGCATTGAGAC

GGACCGAGTGACTAAGGAGTTCATAGACTTTCTCAAGACCTTCCACAAGACAGGCCAAGAAGTCTATAAACAGACGAAGATGTTTTTGGAAGCAATGCCT

TATAAAAGG - UNI7437 - GATTTAAGCATCGAGGAACAGTCAGAATGTACTCAGGACTTTTACCAAAATGTGGCTGAAAGAATGCAGACCCGTGGG

AAAG TGCCTCCAGAGAAAGTGGAGAAGATAATGGATCAGATCGAAAAGCACATCATGACGCGTCTCTATAAATTTGTGTTCTGCCCAGAGACTACTGAT

GATGAGAAGAAAGATCTCGCCATTCAAAAAAGAATCAG GGCCCTGCACTGGGTAACGCCTCAGATGCTCTGTGTCCCTGTCAATGAGGAAATCCCTGAA

GTGTCCGACATGGTGGTGAAAGCGATCACAG ACATCATTGAGATGGACTCAAAGCGTGTGCCTCGGGACAAGCTGGCCTGCATCACCAGGTGCAGCAAG

CACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCAGCCTCTGCCGATGACTTCCTGCCCACCCTGATCTACATCGTCCTGAAGGGCAACCCCCCTC

GCCTGCAGTCCAACATCCAGTACATCACTCGCTTCTGCAACCCCAGCCGGCTCATGACGGGCGAGGATGGCTACTACTTCACCAACCTG TGCTGTGCTG

TGGCTTTCATTGAGAAATTAGACGCCCAGTCTTTGAATTTAAGTCAGGAGGATTTTGACCGGTACATGTCTGGCCAGACATCCCCCAGGAAGCAGGAGTC

TGAGAGTTGGCCCCCGGAGGCCTGCTTAGGTGTGAAGCAAATGTATAAGAACTTGGACCTCCTGTCTCAGTTGAATGAACGGCAAGAAAGGATCATGAAC

GAAGCCAAGAAACTTGAAAAAGACTTAATAGACTGGACAGACGGGATTGCCAAGGAAGTTCAAGACATTGTTGAGAAATACCCACTGGAGATTAAGCCCC

CGAACCAACCCTTAGCAGCCATCGACTCTGAGAATGTGGAGAACGACAAGCTCCCTCCCCCTCTGCAGCCTCAGGTGTACGCAGGGTGACGGCCCTGTTT

ATTTGGGGCTGGTTTCTGGGAGCTGCTGCGTTCCACTGTTCAGGTCCGGAATATGAACTGACTGCTTAAAGTTTCAAAGTGTTTTTAGGTACAGATTTAG

GGATTGGTTATTCTCTTTTTTCTTCTCTAGCGGGGAAGCTTAGTAAATAATAATGTACTATTTATTTGAGCTGGTGGAGTAGGTTTGTGTGAATTCTGTG

TCGCTCTTTTATGTCCTGCCTGATTTCCCATGGGCTTCCTCTGTGTAGACACTGTTGTTGGTTTTGGGCAAACACTGCCTTTTAAAGGATAAAACAGATG

CTATAAAGTCTATGTTGAAATGAATTCTATGTTCCCACACTCCCCCAGTGTGAAATAATTTTGTAATTGTAAAGATAGAAGATAATGTTAATAAGTAAAT

ATGTAAAATTGTAAATATGTAAAAAAAAAACACATAGGGCTGGGGAGGGGTGTCTCAGCGTGCATGGCATTTCATGAGCTGATGTTTTTTTTTTTTTTTT

AGGTGAAAATGAAATTTATTGAATGTTTGCCTTTAGCGCCATTTTATATGGTTTGTCCCACTAAAAAGAATCTAAAGAATTTGAGCTTTAACAGGACATT

GGCACTAACTGCCCTAACTTGAGATTCTTTCTGGTACATGTGAAGAAGTTGTAACGCCAACTTTTAGGTCACATACAGAATTATTCTGGGACCCTGGGGT

GGTGGCTCAGTCAGTAAAGTGCTCTCCATACTGATGTGAGGACCTGAGCTCCCTGTCCGGCCCCGGGTGAAAAGCTGGGCATGGTGACACTCACTTGGGA

CAGCTCTGCTGGGAGCCAGAGTTCCTGGGGCAGGGGGCATCGCTGTCAATGAGACACCTCGTGTAAGCAAACAAATCAAGATGGACGGCTCCTGAGAAAT

GATAGCCAAGGATGCCCTCTGGCCTCCACATGGCCACATATGTGCCTGTGTACCTCTACATACATGTGTAGCACACACACATGAACACACAGTTGCTGAT

TAGTACAGTTGACTTGGAACTGTGCTTGCAGCTTCCTTTCCCTGTTTATCCAATAAACTTCCCCCACAGTGCTGTGGGGCTATTGCCTTTTTTATCTGA
Translation
 - UNI7750 - - UNI16716 - - UNI31250 - MSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKARQRQIQEDWELAER 

- UNI16716 - - UNI21855 - RLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRAGSKKE - UNI7437 - - UN

I34133 - EIQEAKAPSPSINRQTSIETDRVTKEFIDFLKTFHKTGQEVYKQTKMFLEAMPYKR - UNI7437 - DLSIEEQSECTQDFYQNVAERM

QTRGKV VPPEKVEKIMDQIEKHIMTRLYKFVFCPETTDDEKKDLAIQKRIR RALHWVTPQMLCVPVNEEIPEVSDMVVKAITD DIIEMDSKRVPRDK

LACITRCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNL CCAVAFIEKLDAQSLNLSQEDFDRYMS

GQTSPRKQESESWPPEACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAKEVQDIVEKYPLEIKPPNQPLAAIDSENVENDKLPPPLQP

QVYAG
Transcript ENSMUST00000119027
Sequence
AGTATTAGTCTCTTAAGGTGCTCTGTGAATTTCAGACCTCAGATGAAGTCGTTCTTTACTATGACTCTACTTGAATTTGCGTGTTTAACTTTGGTTTTTC

TACTTTCTTCTCTCCTTCTGTTCTTTCTCCCCTATGGCTTGAAGATCTCAGACTCATTTGTATTTTGCTTTATAAATGTTGTATTTTAATAGTATGGAAG

TAAATTAATTTTCAGTGCTTTTTCACTCCTTGGTTATCAGGAAGAAGATGAGCCTGAAGTCCGAACGCAGGGGAATTCATGTGGATCAATCTGAGCTCCT

GTGCAAGAAAGGATGCGGTTACTACGGCAACCCTGCCTGGCAGGGTTTCTGCTCCAAGTGCTGGAGGGAGGAGTACCACAAGGCCCGGCAGAGGCAGATC

CAAGAGGACTGGGAACTGGCAGAACG - UNI16716 - - UNI21855 - ACTTCAGCGGGAGGAGGAAGAGGCCTTCGCGAGCAGCCAGAGCAGCC

AAGGAGCCCAGTCCCTCACCTTCTCCAAGTTCGAGGAGAAGAAGACCAATGAGAAAACCCGAAAAGTCACCACAGTGAAGAAGTTCTTCAGCGCCTCTTC

CAGAGCTGGATCCAAGAAGG - UNI34133 - CAGAAATTCAGGAAGCCAAAGCTCCCAGTCCCTCCATAAACCGGCAAACCAGCATTGAGACGGACC

GAGTGACTAAGGAGTTCATAGACTTTCTCAAGACCTTCCACAAGACAGGCCAAGAAGTCTATAAACAGACGAAGATGTTTTTGGAAGCAATGCCTTATAA

AAGG - UNI7437 - GATTTAAGCATCGAGGAACAGTCAGAATGTACTCAGGACTTTTACCAAAATGTGGCTGAAAGAATGCAGACCCGTGGGAAAG 

TGCCTCCAGAGAAAGTGGAGAAGATAATGGATCAGATCGAAAAGCACATCATGACGCGTCTCTATAA
Translation
MSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKARQRQIQEDWELAER - UNI16716 - - UNI21855 - RLQREEEEAFASS

QSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRAGSKKA - UNI34133 - AEIQEAKAPSPSINRQTSIETDRVTKEFIDFLKTFHKTGQEV

YKQTKMFLEAMPYKR - UNI7437 - DLSIEEQSECTQDFYQNVAERMQTRGKV VPPEKVEKIMDQIEKHIMTRLY

For any suggestions or comments, please send an email to unitrap@crg.es