Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025405 (Inhbc)
Chromosomal location
Chr 10: 126793384 - 126807487 (-)
Description
inhibin beta-C Gene [Source:MGI Symbol;Acc:MGI:105932]
RefSeq_dna
NM_010565 
RefSeq_peptide
NP_034695.1 
UniGene
Mm.2594 
MGI
MGI:105932 
Uniprot/SWISSPROT
P55104 
Uniprot/SPTREMBL
Q3V2A6 
Human Ortholog
ENSG00000175189 (INHBC)
Omim not available
UniTrap UNI13119
Vector Insertion
Chr 10: 126794886 - 126807136
Public Clones CMHD-GT_505F3-3 (cmhd) CMHD-GT_328C1-3 (cmhd) CMHD-GT_326A1-3 (cmhd) CMHD-GT_543E6-5S (cmhd)
PST10836-NL (escells) IST13760F10 (tigm) IST10906D9 (tigm) IST14039C10 (tigm)
IST13041E12 (tigm) IST14698G7 (tigm) IST13805E7 (tigm) IST11169A2 (tigm)
IST14666H12 (tigm) IST12984D10 (tigm) IST14789B9 (tigm) IST13589B11 (tigm)
IST14381B4 (tigm) IST14586C4 (tigm) IST13859F7 (tigm) IST13608G6 (tigm)
IST12926F8 (tigm) IST14642G10 (tigm) IST12143H4 (tigm) IST14626G11 (tigm)
IST14444G11 (tigm) IST13039E12 (tigm) IST13157F3 (tigm) IST11490H7 (tigm)
IST14830E9 (tigm) IST13961E12 (tigm) IST13194F12 (tigm) IST14856B6 (tigm)
IST12260H5 (tigm) IST12435A3 (tigm) IST13178A7 (tigm) IST13390F8 (tigm)
IST14799G1 (tigm) IST13381A10 (tigm) IST14479B6 (tigm) IST11538C7BBF1 (tigm)
IST13624G9 (tigm) IST12719B1 (tigm) IST14441G6 (tigm) IST13433B9 (tigm)
IST14814B3 (tigm) IST11373F4 (tigm) IST14401F2 (tigm) IST14126F4 (tigm)
IST14595G4 (tigm)
Private Clones OST411906 (lexicon) OST389544 (lexicon) OST356742 (lexicon) OST352391 (lexicon)
OST283240 (lexicon) OST268685 (lexicon) OST262453 (lexicon) OST176159 (lexicon)
OST176123 (lexicon) OST159376 (lexicon) OST157199 (lexicon) OST146638 (lexicon)
OST145009 (lexicon) OST144997 (lexicon) OST123475 (lexicon) OST117869 (lexicon)
OST115673 (lexicon) OST114462 (lexicon) OST105437 (lexicon) OST76069 (lexicon)
OST57188 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000026472
Sequence
GGCTTTGGGTCCTTTAAGGAGGCTATCCTCCAGCAATGGCCTCCTCCTTGCTCCTGGCTCTTCTGTTCCTGACTCCAACCACAGTAGTGAACCCCAAAAC

TGAGGGTCCATGCCCAGCATGTTGGGGTGCCATCTTTGACCTGGAGAGCCAGCGGGAGCTGCTTCTCGATTTGGCCAAGAAAAGTATCCTGGACAAGCTG

CACCTCAGCCAGCGCCCCATACTCAGTCGGCCAGTGTCCAGAGGGGCTCTCAAGACCGCGCTGCAGCGCCTCCGCGGGCCTCGACGGGAAACCCTGTTGG

AGCATGACCAGAGACAAGAAGAATATGAGATCATCAGCTTTGCTGACACAG - UNI13119 - ACCTCTCCAGCATCAACCAGACCCGGCTCGAGTTC

CACTTCTCTGGTAGAATGGCCAGCGGCATGGAGGTCCGGCAGACCCGCTTCATGTTCTTCGTACAGTTCCCCCACAATGCCACCCAGACCATGAATATAA

GAGTTCTTGTGCTAAGACCATATGACACCAACCTCACCTTGACAAGTCAGTACGTGGTGCAGGTGAATGCCAGTGGCTGGTACCAGCTTCTCCTGGGACC

TGAAGCTCAAGCTGCTTGCAGCCAGGGACACCTTACTCTGGAGCTGGTACCAGAAAGCCAGGTGGCCCACAGTTCCTTGATCCTGGGCTGGTTTTCCCAC

AGGCCTTTTGTGGCAGCCCAGGTAAGGGTTGAGGGCAAGCATCGGGTTCGCCGGCGAGGTATCGATTGCCAGGGGGCGTCCAGGATGTGCTGTCGACAAG

AGTTCTTCGTAGACTTCCGTGAGATTGGCTGGAATGACTGGATCATCCAGCCTGAAGGCTATGCCATGAACTTCTGCACTGGGCAGTGCCCACTACATGT

GGCAGGCATGCCTGGCATCTCTGCCTCCTTTCACACTGCAGTGCTGAATCTGCTCAAAGCCAACGCAGCTGCTGGCACCACTGGCAGGGGCTCGTGCTGC

GTGCCTACATCTCGGCGCCCTCTGTCTTTGCTCTACTATGACAGGGACAGCAACATTGTCAAGACGGATATACCTGACATGGTGGTCGAGGCCTGCGGGT

GTAGTTAGCTTATGGGTGATACAGGCTGCCTGAGGTAGAATGGCCTTCCTCAGGAAGGGGAAACTCTGTTCCCACTTCTGTCCAGAATGGAAACACCTTT

CTAAGCATGCAGACATCCCTCTGTGGACTTCAGGGGATCCACCTCTAAAGAGAGTCACTAGTGACCAACAGCCTTTCTCTCTCCTGGGACATGGTTGACC

CAGTACACCCATCCTCAGCCTTAAGCTAGAGGCTAATCGACTGCCTACCACAAGCAATGTCATTTTGTTCCTGGCAAACACACCCTTAGCTCTCCCTTAG

TCAACTATGTAATCTACTCTGCCTCCCTGACCCTGCCACCGGAAGGTTCCTATTCCACGATGATATGCCTTAGTGTCTCCCCTTGAATTCTGTGGCTCTC

CGAAGAACCCCTTCATCAGGGTCACTGAAGATTATATTGCTGCCTTCCAAAGAAAGGCTCATCTCTCAAATCTGGAGACCCGAGCCCAGATGTGCTACTA

AATAGTGTTCTCTGCCCTCTTCTGCCCTCGGGGGTGACATACCAAGTCTCATTGGTTGGACATTCCTCTAGTTTCCAGCTGAATTTGACCAAAAGGAGAC

TCCAGTTGGAAACTAAAGCCTAGGATAACACAGAAAAACTCCATCAGGCATAGTGGCTCACATGGACAAGTCCAGCCCTGCACACGAGAGACTGAGGCCA

GCTAGCTCTAGGCTAGCCTGGGTTATGCCATTAAGACCTTTGTCACAAAGTAAAAGAAGGAAGAATG
Translation
MASSLLLALLFLTPTTVVNPKTEGPCPACWGAIFDLESQRELLLDLAKKSILDKLHLSQRPILSRPVSRGALKTALQRLRGPRRETLLEHDQRQEEYEII

SFADTD - UNI13119 - DLSSINQTRLEFHFSGRMASGMEVRQTRFMFFVQFPHNATQTMNIRVLVLRPYDTNLTLTSQYVVQVNASGWYQLLLGPE

AQAACSQGHLTLELVPESQVAHSSLILGWFSHRPFVAAQVRVEGKHRVRRRGIDCQGASRMCCRQEFFVDFREIGWNDWIIQPEGYAMNFCTGQCPLHVA

GMPGISASFHTAVLNLLKANAAAGTTGRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

For any suggestions or comments, please send an email to unitrap@crg.es