Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025491 (Ifitm1)
Chromosomal location
Chr 7: 148153120 - 148155724 (+)
Description
interferon induced transmembrane protein 1 Gene [Source:MGI (curated);Acc:Ifitm1-001]
RefSeq_dna
NM_026820 
RefSeq_peptide
NP_081096.3 NP_001106186.1 
UniGene
Mm.403369 
MGI
MGI:1915963 
Uniprot/SPTREMBL
Q8R2S7 Q9D103 
Human Ortholog
ENSG00000185885 (IFITM1)
Omim not available
UniTrap UNI29936
Vector Insertion
Chr 7: 148153951 - 148154138
Public Clones D187F01 (ggtc) IST14424F6 (tigm) IST15082A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15856
Vector Insertion
Chr 7: 148154130 - 148154338
Public Clones not available
Private Clones OST471536 (lexicon) OST466314 (lexicon) OST460677 (lexicon) OST355312 (lexicon)
OST325940 (lexicon) OST268071 (lexicon) OST268067 (lexicon) OST265613 (lexicon)
OST245652 (lexicon) OST243745 (lexicon) OST234523 (lexicon) OST204526 (lexicon)
OST177110 (lexicon) OST69100 (lexicon) OST33127 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13978
Vector Insertion
Chr 7: 148154338 - 148155387
Public Clones (sanger) CMHD-GT_133A8-3 (cmhd) CMHD-GT_389H5-3 (cmhd) IST12426E9 (tigm)
IST13614G10 (tigm) IST13082G3 (tigm)
Private Clones OST417676 (lexicon) OST404376 (lexicon) OST398716 (lexicon) OST353561 (lexicon)
OST316022 (lexicon) OST306743 (lexicon) OST242195 (lexicon) OST230713 (lexicon)
OST218207 (lexicon) OST192951 (lexicon) OST146539 (lexicon) OST96752 (lexicon)
OST63923 (lexicon) OST27726 (lexicon) OST20978 (lexicon) OST13373 (lexicon)
OST8086 (lexicon) OST5543 (lexicon)
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000026564
Sequence
CTCTGCAGCTTCAAAAGCCGAGAGATGCCTAAGGAGCAGCAAGAGGTGGTTGTACTGGGGTCACCCCACATCTCAACTTCTGCGACAGCCACCACAATCA

ACATGCCTGAGATCTCCACGCCTGACCATGTGGTCTGGTCCCTGTTCAATACACTCTTCATGAACTTCTGCTGCCTGGGCTTCGTAGCCTATGCCTACTC

CGTGAAG - UNI13978 - - UNI15856 - TCTAGGGACAGGAAGATGGTGGGTGATACGACTGGGGCCCAGGCCTTCGCCTCCACCGCCAAGTGC

CTGAACATCAGCTCCCTGTTCTTCACCATCCTCACGGCCATCGTCGTCATCGTTGTCTGTGCCATTAGATGATGTGAGATGTCTTGCAACATCTCACAGT

AGATAACAGATTCTGGGGCCTCCCAGGCTTGCTATGTGTTTCCTTGTCTATCGCTGCCCCAAACCCTAGACTTAGTCCTGACCATTTGCCCCATACATAT

GCAAATGTGACACTCACAAATCTGTCCATGGTGGACTCAATAAAGTGCACGTGCTGTGACTTTC
Translation
MPKEQQEVVVLGSPHISTSATATTINMPEISTPDHVVWSLFNTLFMNFCCLGFVAYAYSVK - UNI13978 - - UNI15856 - SRDRKMVGDTTG

AQAFASTAKCLNISSLFFTILTAIVVIVVCAIR
Transcript ENSMUST00000106042
Sequence
GGCGCTTTTTTGTTTTTGCTTTGCTTTGCTTTTTTGTTTTTCCTGGTTGGATTATTTGAGGTCAGAAAAGCCACCCTAAATGTGGGCCACACCTTCTGGT

GGCACCCCACATAAAAGGTCATGGAAGAAGGATGGTTTTGCCTGCTTACCCTCTTGCTGCTCAGTTTCTCTCTCCTGTTCCAGAGATATTAGAACCTACT

TCCTCAGGGTCCCAACGGACCTCTGTAGAATCTCCCTGGGACTCTAGCACCACATTGACACAGCTGACTTTAGTCTTGTGGACAACGCCTGGATCCTAGG

CCTTTCCATCAGGAGACAGTCATTTTAGGGCTCCTCGACCACACCT - UNI15856 - - UNI29936 - CTTCAAAAGCCGAGAGATGCCTAAGGA

GCAGCAAGAGGTGGTTGTACTGGGGTCACCCCACATCTCAACTTCTGCGACAGCCACCACAATCAACATGCCTGAGATCTCCACGCCTGACCATGTGGTC

TGGTCCCTGTTCAATACACTCTTCATGAACTTCTGCTGCCTGGGCTTCGTAGCCTATGCCTACTCCGTGAAG - UNI13978 - - UNI15856 - T

CTAGGGACAGGAAGATGGTGGGTGATACGACTGGGGCCCAGGCCTTCGCCTCCACCGCCAAGTGCCTGAACATCAGCTCCCTGTTCTTCACCATCCTCAC

GGCCATCGTCGTCATCGTTGTCTGTGCCATTAGATGATGTGAGATGTCTTGCAACATCTCACAGTAGATAACAGATTCTGGGGCCTCCCAGGCTTGCTAT

GTGTTTCCTTGTCTATCGCTGCCCCAAACCCTAGACTTAGTCCTGACCATTTGCCCCATACATATGCAAATGTGACACTCACAAATCTGTCCATGGTGGA

CTCAATAAAGTGCACGTGCTGTGACTTTCTGCCCCT
Translation
 - UNI15856 - - UNI29936 - MPKEQQEVVVLGSPHISTSATATTINMPEISTPDHVVWSLFNTLFMNFCCLGFVAYAYSVK - UNI13978 

- - UNI15856 - SRDRKMVGDTTGAQAFASTAKCLNISSLFFTILTAIVVIVVCAIR
Transcript ENSMUST00000106040
Sequence
GCTCTCCCTGCCCACACCCTAATG - UNI15856 - - UNI29936 - CTTCAAAAGCCGAGAGATGCCTAAGGAGCAGCAAGAGGTGGTTGTACTG

GGGTCACCCCACATCTCAACTTCTGCGACAGCCACCACAATCAACATGCCTGAGATCTCCACGCCTGACCATGTGGTCTGGTCCCTGTTCAATACACTCT

TCATGAACTTCTGCTGCCTGGGCTTCGTAGCCTATGCCTACTCCGTGAAG - UNI13978 - - UNI15856 - TCTAGGGACAGGAAGATGGTGGG

TGATACGACTGGGGCCCAGGCCTTCGCCTCCACCGCCAAGTGCCTGAACATCAGCTCCCTGTTCTTCACCATCCTCACGGCCATCGTCGTCATCGTTGTC

TGTGCCATTAGATGATGTGAGATGTCTTGCAACATCTCACAGTAGATAACAGATTCTGGGGCCTCCCAGGCTTGCTATGTGTTTCCTTGTCTATCGCTGC

CCCAAACCCTAGACTTAGTCCTGACCATTTGCCCCATACATATGCAAATGTGACACTCACAAATCTGTCCATGGTGGACTCAATAAAGTGCACGTGCTGT

GACTTTCTGCCCCT
Translation
 - UNI15856 - - UNI29936 - MPKEQQEVVVLGSPHISTSATATTINMPEISTPDHVVWSLFNTLFMNFCCLGFVAYAYSVK - UNI13978 

- - UNI15856 - SRDRKMVGDTTGAQAFASTAKCLNISSLFFTILTAIVVIVVCAIR

For any suggestions or comments, please send an email to unitrap@crg.es