Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025525 (Apool)
Chromosomal location
Chr X: 109424975 - 109486039 (+)
Description
apolipoprotein O-like Gene [Source:MGI (curated);Acc:Apool-003]
RefSeq_dna
NM_026565 
RefSeq_peptide
NP_080841.1 
MGI
MGI:1915367 
Uniprot/SWISSPROT
Q78IK4 
Uniprot/SPTREMBL
Q9CZB4 B1AV14 B1AV13 
Human Ortholog
ENSG00000155008 (APOOL)
Omim not available
UniTrap UNI2960
Vector Insertion
Chr X: 109467862 - 109477765
Public Clones AC0470 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113413
Sequence
ATAGCTGTTTTTAGAAG CCCCATATATACTGCACCACCCCTCCATTCTAAATATGTTGAAGAACAGCCTGGTAATTTACAAAGGGGCTTTGCATCCATC

CGTACTACAACCGTGTATTATATTGGCTGGTGCAAG AGCATTTATCTCTTTATGAAGAATGGGGTTATGGATACAGTACAGTTTGGAAAAG ATGCATA

TGTCTATCTGAAGAATCCTCCGCAAGATTTTCTCCCCAAAATGGGAGTGATTACAGCTTCGGGACTGGCAGGTTTGCTTTCAGCAAGAAAAG GTTCCAG

GTTTAAGAAGATTGCTTATCCACTAGGACTGGCCACATTAGGAGCGACTGTTTGCTACCCAGCTCAGTCAGTAATAATTGCAAAG - UNI2960 - GA

AGGAAGGTCTGATGAAATCCATGCCAGCTTGCCTGACCTGAAACATTCAGTGTCTTTGCCAAAAGAACTTGCCTCTGCAACAGTGATTAAATCAGAATCT

ACCTCAG GTACTACACAGTTCATTCCTGACCCCAAGCTCATGGATCATGGGCAGTCTCATCCAGATGATAAAGATATGTACAGCACTAGAAGCTGAACT

AGTTTGCAGAGGGAGCCTGCATAGAGAACTGCAAGATGTACCAAGTTGCAAACAATGGTGAAAAATCACATAATGAACGGGTAACTGACAAAATGTGACT

TGAAATTTTTCCACGACATTTTCAAATAAACAGTTTGGCCAATG
Translation
IAVFRS SPIYTAPPLHSKYVEEQPGNLQRGFASIRTTTVYYIGWCK SIYLFMKNGVMDTVQFGKD DAYVYLKNPPQDFLPKMGVITASGLAGLLSAR

KG GSRFKKIAYPLGLATLGATVCYPAQSVIIAK - UNI2960 - EGRSDEIHASLPDLKHSVSLPKELASATVIKSESTSG GTTQFIPDPKLMDHG

QSHPDDKDMYSTRS
Transcript ENSMUST00000113414
Sequence
ATGTGTCTTTTTCAGATGGGAAAGTTGACAACCATACCTGCAGGTCTGATATATGCATCTATAAATGTGCGTCTTGCCAAAGAAGAGGAACCCAAAAAGC

AGCTA TCCTCGTG GAGAGTTAGCTCA CTCCCCATATATACTGCACCACCCCTCCATTCTAAATATGTTGAAGAACAGCCTGGTAATTTACAAAGGGG

CTTTGCATCCATCCGTACTACAACCGTGTATTATATTGGCTGGTGCAAG AGCATTTATCTCTTTATGAAGAATGGGGTTATGGATACAGTACAGTTTGG

AAAAG ATGCATATGTCTATCTGAAGAATCCTCCGCAAGATTTTCTCCCCAAAATGGGAGTGATTACAGCTTCGGGACTGGCAGGTTTGCTTTCAGCAAG

AAAAG GTTCCAGGTTTAAGAAGATTGCTTATCCACTAGGACTGGCCACATTAGGAGCGACTGTTTGCTACCCAGCTCAGTCAGTAATAATTGCAAAG -

 UNI2960 - ATAACTGGGAAAAAGGCATATGCTACAAGCCAGCAAATTTTTCAAGCCATTAAGTCATTGTGGACACAAAAAAGTGAAAACGAATCACT

CCCTGAACCAAAGGAAGAAAGCAAG GAAGGAAGGTCTGATGAAATCCATGCCAGCTTGCCTGACCTGAAACATTCAGTGTCTTTGCCAAAAGAACTTGC

CTCTGCAACAGTGATTAAATCAGAATCTACCTCAG GTACTACACAGTTCATTCCTGACCCCAAGCTCATGGATCATGGGCAGTCTCATCCAGATGATAA

AGATATGTACAGCACTAGAAGCTGAACTAGTTTGCAGAGGGAGCCTGCATAGAGAACTGCAAGATGTACCAAGTTGCAAACAATGGTGAAAAATCACATA

ATGAACGGGTAACTGACAAAATGTGACTTGAAATTTTTCCACGACATTTTCAAATAAACAGTTTGGCCAATG
Translation
MCLFQMGKLTTIPAGLIYASINVRLAKEEEPKKQL SSW WRVSS LPIYTAPPLHSKYVEEQPGNLQRGFASIRTTTVYYIGWCK SIYLFMKNGVMDT

VQFGKD DAYVYLKNPPQDFLPKMGVITASGLAGLLSARKG GSRFKKIAYPLGLATLGATVCYPAQSVIIAK - UNI2960 - ITGKKAYATSQQIF

QAIKSLWTQKSENESLPEPKEESK EGRSDEIHASLPDLKHSVSLPKELASATVIKSESTSG GTTQFIPDPKLMDHGQSHPDDKDMYSTRS
Transcript ENSMUST00000113415
Sequence
CTGCTTTGTCCCTCTGCGCTCTCCGTCTGAAAACTTGAGCCGAGAGGGTCATAGGTATGGCGGCCTTTAGG CTCCCCATATATACTGCACCACCCCTCC

ATTCTAAATATGTTGAAGAACAGCCTGGTAATTTACAAAGGGGCTTTGCATCCATCCGTACTACAACCGTGTATTATATTGGCTGGTGCAAG AGCATTT

ATCTCTTTATGAAGAATGGGGTTATGGATACAGTACAGTTTGGAAAAG ATGCATATGTCTATCTGAAGAATCCTCCGCAAGATTTTCTCCCCAAAATGG

GAGTGATTACAGCTTCGGGACTGGCAGGTTTGCTTTCAGCAAGAAAAG GTTCCAGGTTTAAGAAGATTGCTTATCCACTAGGACTGGCCACATTAGGAG

CGACTGTTTGCTACCCAGCTCAGTCAGTAATAATTGCAAAG - UNI2960 - GAAGGAAGGTCTGATGAAATCCATGCCAGCTTGCCTGACCTGAAAC

ATTCAGTGTCTTTGCCAAAAGAACTTGCCTCTGCAACAGTGATTAAATCAGAATCTACCTCAG GTACTACACAGTTCATTCCTGACCCCAAGCTCATGG

ATCATGGGCAGTCTCATCCAGATGATAAAGATATGTACAGCACTAGAAGCTGAACTAGTTTGCAGAGGGAGCCTGCATAGAGAACTGCAAGATGTACCAA

GTTGCAAACAATGGTGAAAAATCACATAATGAACGGGTAACTGACAAAATGTGACTTGAAATTTTTCCACGACATTTTCAAATAAACAGTTTGGCCAATG

A
Translation
MAAFR LPIYTAPPLHSKYVEEQPGNLQRGFASIRTTTVYYIGWCK SIYLFMKNGVMDTVQFGKD DAYVYLKNPPQDFLPKMGVITASGLAGLLSARK

G GSRFKKIAYPLGLATLGATVCYPAQSVIIAK - UNI2960 - EGRSDEIHASLPDLKHSVSLPKELASATVIKSESTSG GTTQFIPDPKLMDHGQ

SHPDDKDMYSTRS
Transcript ENSMUST00000026599
Sequence
AGAGGGTCATAGGTATGGCGGCCTTTAGG ATGGGAAAGTTGACAACCATACCTGCAGGTCTGATATATGCATCTATAAATGTGCGTCTTGCCAAAGAAG

AGGAACCCAAAAAGCAGCTAGTGAGACCGGATCAG CTCCCCATATATACTGCACCACCCCTCCATTCTAAATATGTTGAAGAACAGCCTGGTAATTTAC

AAAGGGGCTTTGCATCCATCCGTACTACAACCGTGTATTATATTGGCTGGTGCAAG AGCATTTATCTCTTTATGAAGAATGGGGTTATGGATACAGTAC

AGTTTGGAAAAG ATGCATATGTCTATCTGAAGAATCCTCCGCAAGATTTTCTCCCCAAAATGGGAGTGATTACAGCTTCGGGACTGGCAGGTTTGCTTT

CAGCAAGAAAAG GTTCCAGGTTTAAGAAGATTGCTTATCCACTAGGACTGGCCACATTAGGAGCGACTGTTTGCTACCCAGCTCAGTCAGTAATAATTG

CAAAG - UNI2960 - ATAACTGGGAAAAAGGCATATGCTACAAGCCAGCAAATTTTTCAAGCCATTAAGTCATTGTGGACACAAAAAAGTGAAAACG

AATCACTCCCTGAACCAAAGGAAGAAAGCAAG GAAGGAAGGTCTGATGAAATCCATGCCAGCTTGCCTGACCTGAAACATTCAGTGTCTTTGCCAAAAG

AACTTGCCTCTGCAACAGTGATTAAATCAGAATCTACCTCAG GTACTACACAGTTCATTCCTGACCCCAAGCTCATGGATCATGGGCAGTCTCATCCAG

ATGATAAAGATATGTACAGCACTAGAAGCTGAACTAGTTTGCAGAGGGAGCCTGCATAGAGAACTGCAAGATGTACCAAGTTGCAAACAATGGTGAAAAA

TCACATAATGAACGGGTAACTGACAAAATGTGACTTGAAATTTTTCCACGACATTTTCAAATAAACAGTTTGGCCAATG
Translation
MAAFR MGKLTTIPAGLIYASINVRLAKEEEPKKQLVRPDQ LPIYTAPPLHSKYVEEQPGNLQRGFASIRTTTVYYIGWCK SIYLFMKNGVMDTVQFG

KD DAYVYLKNPPQDFLPKMGVITASGLAGLLSARKG GSRFKKIAYPLGLATLGATVCYPAQSVIIAK - UNI2960 - ITGKKAYATSQQIFQAIK

SLWTQKSENESLPEPKEESK EGRSDEIHASLPDLKHSVSLPKELASATVIKSESTSG GTTQFIPDPKLMDHGQSHPDDKDMYSTRS

For any suggestions or comments, please send an email to unitrap@crg.es