Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025529 (Zfp711)
Chromosomal location
Chr X: 109714135 - 109748679 (+)
Description
zinc finger protein 711 Gene [Source:MGI (curated);Acc:Zfp711-003]
RefSeq_dna
NM_177747 
RefSeq_peptide
NP_808415.2 
UniGene
Mm.259846 
MGI
MGI:3045342 
Uniprot/SPTREMBL
A2ANX9 A2ANY0 Q8BYM9 
Human Ortholog
ENSG00000147180 (ZNF711)
Omim not available
UniTrap UNI32777
Vector Insertion
Chr X: 109738487 - 109740778
Public Clones IST14444G6 (tigm) IST14248F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000071814
Sequence
GTGAATGAGCTTTGCTAAGGATGGAGTCAGGTGGTGGAAGTCTTGGATTGCACACTTCAGATGCTAGAATGGCTCATACCATGATTATGCAGGATTTTG 

TGGCTGGAATGGCTGGTACTGCACATATCGATGGAGACCATATTGTAGTTTCAGTTCCTGAAGCTGTATTAGTTTCTGATGTTGTCACAGATGATGGGAT

AACTCTCGATCATGGCCTTGCAGCTGAAGTTGTCCATGGGCCTGATATTATTACAGAGACTGATGTGGTAACAGAAGGGGTGATTGTTCCTGAAGCTGTG

CTTGAAGCCGATGTTGCCATTGAAGAAGATTTGGAAGAAGATGATGGAGATCATATCTTAACTTCTGAGCTTATTACAGAAACCGTTAGGGTACCTGAGC

AGGTTTTTGTGGCTGATCTTGTTTCTGGTCCTGATGGACATTTGGAACATGTGGTCCAAGATTGTGTTTCAGGTGTGGACTCTCCCACAATGGTGTCAGA

AGAAGTTCTTGTAACTAATTCAGATACAGAAACTGTGATTCAAGCAGGTGGTGGTGTTCCTGGTTCTACTGTTACCATAAAAACGGAAGAAGATGATGAT

GATGATGTCAAGAGCACTTCCGAAGACTACTTAATGATATCTT TGGATGATGTGGGAGAGAAGTTAGAGCATATGGGGAACACGCCATTGAAAATCGCT

AGCGATGGTTCACAAGAAGATGTTAAAGAAGATGCATTTGGTTCAGAAGTGATAAAAGTATATATCTTTAAAGCAGAGGCTGAAGATGATGTTGAAATAG

 GTGGGACAGAAATTGTCACAGAGAGTGAATACAGCAGTGGCCATTCTGTAGCTGGAGTGCTTGACCAGAGCCGAATGCAGCGAGAGAAAATGGTTTACA

TGGCAGTGAAAGATTCTTCCCAGGAACAGGATGATATCAG - UNI32777 - AGATGAGAGACGAGTTTCTCGAAGGTATGAAGAATGTCAAGCACCA

GG AAACACTTTTGACTCAGCATTAGAAAACAGAAACACTACAGCAGCACAGTACCTTCAAATTTGTGATAGCATGAACACAAATAAAGTTCTTAAACAA

AAAATCAAGAAGAGGAGAAGGGGAGAAACAAGGCAGTGGCAAACAG CTGTTATAATAGGTCCTGATGGACAGCCCTTGACAGTATACCCTTGCCATATT

TGCACAAAAAAGTTTAAATCCAGGGGATTCTTAAAAAGACACATGAAGAATCATCCCGATCATTTGATGAGAAAGAAGTACCAGTGTACAGATTGTGATT

TCACAACTAACAAGAAAGTGAGTTTCCATAACCACTTAGAAAGCCATAAGCTCATAAACAAGGTTGATAAAACCCATGAATTTACAGAATACACTCGAAG

ATACAGAGAAGCTAGTCCACTGAGTTCAAATAAACTCATTTTAAGAGACAAGGAACCGAAGATGCACAAGTGCAAGTACTGTGATTACGAAACTGCCGAA

CAAGGACTGTTAAATAGACATTTGCTGGCTGTTCATAGCAAGAGTTTTCCTCATGTTTGTGTTGAGTGTGGGAAGGGTTTTCGTCATCCTTCTGAACTCA

AGAAACATATGAGAACCCATACTGGTGAGAAGCCATATCAGTGTCAGTACTGTGCATTCAGATGTGCAGATCAATCAAACCTGAAAACGCACATTAAGTC

TAAGCATGGTAGCAACTTGCCCTATAAATGTGAGCATTGTCCTCAAGCCTTTGGTGATGAGAGAGAGCTTCAGCGCCATCTGGATTTGTTTCAAGGACAT

AAAACACACCAATGTCCTCATTGTGATCATAAGAGCACCAACTCAAGTGACCTTAAGCGGCACATCATATCTGTCCATACCAAGGACTTTCCTCACAAAT

GTGAAGTCTGTGATAAAGGTTTTCATCGTCCTTCAGAGCTTAAAAAACATAGTGATATTCATAAGGGTAGGAAGATTCACCAGTGTAGGCATTGTGACTT

TAAAACCTCAGATCCATTTATTCTTAGTGGTCATATCCTTTCAGTTCATACTAAAGATCAGTCATTGAAGTGTAAAAGGTGCAAGAGAGGATTCAGACAA

CAGAATGAGCTGAAAAAGCACATGAAGACTCATACTGGAAGGAAGATTTACCAATGTGAATATTGTGAATACAGCACCACAGATGCATCTGGATTCAAAC

GACATGTGATTTCAATACATACGAAAGACTATCCACACAGGTGTGAATTCTGCAAAAAGGGATTCCGAAGACCATCAGAAAAAAAGCAGCATATAATGAG

GCACCACAAGGAGACTCTTATGTAGTAAGATCGAAATAAGGAAAGATGTCATTTACAAAATAAAATATACTATTTGGGAGGAAAATCTCACTGTTTGATC

TGGTTTCAAAGCTTGATATTAAATCATAAATTTACATTCTTTGTATTAAAGATCTTGAAATATTTGGACTAGAAAGGCAGTCTCATAGCCCTTTGAAAAT

TATCTAAAGAATTTAAGGAGTACCATAGGACGGTTGCAGAGGAACTTAACTGTCATTAACAGTATTATATGCATAACTAAACTACAGAGGGGGAAAGTTA

AGACACCTTATTTGATTGGTTACACTAGAGATAAGTGTTTCTGGAAGGAGAATACATAATTGATTTAGAAATGCTTTGCTGTAGCAAGCAGCCTCACTTT

TATGCAATTTTAGAAATAGGGTGGGGAAAGAAAATGCAGTCATCCATCAGTCACTTAGTCATTGAACCTTTTATATTGTACCTGGACATTGGATTCCAGA

AACAGCAAATGTTTTGTGTATTTGTTACAAGGAATCTCACTCTGGTAAAACAAGTTACATTGATTCAGTCCTAGTTTTAAAAAGGCAGAACTTCAGAGTT

GTTGATATTTTATCACAGGACATGAAGTTTAAGACATAGCATTCTGTGCTGAAACCTGAAGGGAAATATAAGAAATAAAGAGTTCCAGTTTTGATGTTCA

AGTAGATTCAGTATGGCATATATGATAAAAGTGTTTGAGTCAAATGTGGCTTTCTAAAATGGATGCAAGTATGTTAAAAAGTCAACACTATGTTTCTTAT

AATCTGAATGTTAAATTGAGAGAACAGTTTTCTTAAATATGAAAATATTTAGAATTTTTAGGGCATTTTTAGTAAGTATGACTCTTCAAGTCTTACTTGC

TCTAATGTTTAAAGGTGCAATTTTATGCCATTATTGAAAATTTTGATTTTTAAAATCTATATACCATATTCTTAACATAAATTTTCAATGAGGTGGTATT

TATGCAGTATTTAACAGAACAATATGCTGCCAATAGAGTTTGGAGGTGGGTATTCAGTTTACAGTGTATAAATTTAAAATATGCATCCCTTAACAACGCT

TTGTGTTAGCATGCTGCAAATCAAAATGGCGCTTAATATTAAAACCTGGTGTAGGGAATTTTAATGAAAATCCTGTTCATAAATGTAATGCATATGATGT

GTACTTTTAAGTTCTAGTCCCCAAATTTAGTTTATATTCAGCTGTTCAGCATAACTAATGTGTAATTTTCCTTCACGCTATATTGTGGCTTTGTGTTTTA

AGTAATATTCTCCTTTCTGTTTTTGCACCAGATAAGAATCTGTTACTTGAAAACAAATTTTTTTATCTTTCTTAACTTCAGAATACTAAATTTGGAAAAT

CTACTAAACTTGTGTGTTATGTGGCTGTAAATGATGTACACGCTGTAAAATAAGATTGTTACTGTTACGTGGACTTATTATTTCTAAATGTTACTCATTG

AAATGAGCATACAATAAAAAGCATTTATTGCACTTCAAA
Translation
MESGGGSLGLHTSDARMAHTMIMQDFV VAGMAGTAHIDGDHIVVSVPEAVLVSDVVTDDGITLDHGLAAEVVHGPDIITETDVVTEGVIVPEAVLEADV

AIEEDLEEDDGDHILTSELITETVRVPEQVFVADLVSGPDGHLEHVVQDCVSGVDSPTMVSEEVLVTNSDTETVIQAGGGVPGSTVTIKTEEDDDDDVKS

TSEDYLMISL LDDVGEKLEHMGNTPLKIASDGSQEDVKEDAFGSEVIKVYIFKAEAEDDVEIG GGTEIVTESEYSSGHSVAGVLDQSRMQREKMVYMA

VKDSSQEQDDIR - UNI32777 - RDERRVSRRYEECQAPG GNTFDSALENRNTTAAQYLQICDSMNTNKVLKQKIKKRRRGETRQWQTA AVIIGP

DGQPLTVYPCHICTKKFKSRGFLKRHMKNHPDHLMRKKYQCTDCDFTTNKKVSFHNHLESHKLINKVDKTHEFTEYTRRYREASPLSSNKLILRDKEPKM

HKCKYCDYETAEQGLLNRHLLAVHSKSFPHVCVECGKGFRHPSELKKHMRTHTGEKPYQCQYCAFRCADQSNLKTHIKSKHGSNLPYKCEHCPQAFGDER

ELQRHLDLFQGHKTHQCPHCDHKSTNSSDLKRHIISVHTKDFPHKCEVCDKGFHRPSELKKHSDIHKGRKIHQCRHCDFKTSDPFILSGHILSVHTKDQS

LKCKRCKRGFRQQNELKKHMKTHTGRKIYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEFCKKGFRRPSEKKQHIMRHHKETLM
Transcript ENSMUST00000039658
Sequence
GCACTCGGACTCCACCGGCGGCGCAGCCTTGGCTGCGAGTCCGCGGGGTCTCCTAGCACGAACCCAGCGCGGGCTCCACGGTCGGCGTGGCGCGCGCGTG

CGCGCGCTCCCCCTTTGGCCCCCTACCCTGCAGCAAGGGTAGCGTGACGTAATGCAACCTCAGCATGTAGGAGCGCTATAAAGCGGGACGAGGCGGCGCG

CCTCGCAGACGCAGAGTAGCTCGTGATTGGCTCGGGCTGCGGAACCTCGGAATCCCGAACGAACGCCAGGACCTTCCAGGTCCACGGCTGCCGCCCCCCG

CGGCAGTTGAGAGCGCGGCCTCCGACTGCCTGGCGGCGGGGAAGGCGGTGGCGGTTGCAGCCCCGCGGAGGCGGTGACAG ATACATGTGAATGAGCTTT

GCTAAGGATGGAGTCAGGTGGTGGAAGTCTTGGATTGCACACTTCAGATGCTAGAATGGCTCATACCATGATTATGCAGGATTTTG TGGCTGGAATGGC

TGGTACTGCACATATCGATGGAGACCATATTGTAGTTTCAGTTCCTGAAGCTGTATTAGTTTCTGATGTTGTCACAGATGATGGGATAACTCTCGATCAT

GGCCTTGCAGCTGAAGTTGTCCATGGGCCTGATATTATTACAGAGACTGATGTGGTAACAGAAGGGGTGATTGTTCCTGAAGCTGTGCTTGAAGCCGATG

TTGCCATTGAAGAAGATTTGGAAGAAGATGATGGAGATCATATCTTAACTTCTGAGCTTATTACAGAAACCGTTAGGGTACCTGAGCAGGTTTTTGTGGC

TGATCTTGTTTCTGGTCCTGATGGACATTTGGAACATGTGGTCCAAGATTGTGTTTCAGGTGTGGACTCTCCCACAATGGTGTCAGAAGAAGTTCTTGTA

ACTAATTCAGATACAGAAACTGTGATTCAAGCAGGTGGTGGTGTTCCTGGTTCTACTGTTACCATAAAAACGGAAGAAGATGATGATGATGATGTCAAGA

GCACTTCCGAAGACTACTTAATGATATCTT TGGATGATGTGGGAGAGAAGTTAGAGCATATGGGGAACACGCCATTGAAAATCGCTAGCGATGGTTCAC

AAGAAGATGTTAAAGAAGATGCATTTGGTTCAGAAGTGATAAAAGTATATATCTTTAAAGCAGAGGCTGAAGATGATGTTGAAATAG GTGGGACAGAAA

TTGTCACAGAGAGTGAATACAGCAGTGGCCATTCTGTAGCTGGAGTGCTTGACCAGAGCCGAATGCAGCGAGAGAAAATGGTTTACATGGCAGTGAAAGA

TTCTTCCCAGGAACAGGATGATATCAG - UNI32777 - AGATGAGAGACGAGTTTCTCGAAGGTATGAAGAATGTCAAGCACCAG GAAACACTTTT

GACTCAGCATTAGAAAACAGAAACACTACAGCAGCACAGTACCTTCAAATTTGTGATAGCATGAACACAAATAAAGTTCTTAAACAAAAAATCAAGAAGA

GGAGAAGGGGAGAAACAAGGCAGTGGCAAACAG CTGTTATAATAGGTCCTGATGGACAGCCCTTGACAGTATACCCTTGCCATATTTGCACAAAAAAGT

TTAAATCCAGGGGATTCTTAAAAAGACACATGAAGAATCATCCCGATCATTTGATGAGAAAGAAGTACCAGTGTACAGATTGTGATTTCACAACTAACAA

GAAAGTGAGTTTCCATAACCACTTAGAAAGCCATAAGCTCATAAACAAGGTTGATAAAACCCATGAATTTACAGAATACACTCGAAGATACAGAGAAGCT

AGTCCACTGAGTTCAAATAAACTCATTTTAAGAGACAAGGAACCGAAGATGCACAAGTGCAAGTACTGTGATTACGAAACTGCCGAACAAGGACTGTTAA

ATAGACATTTGCTGGCTGTTCATAGCAAGAGTTTTCCTCATGTTTGTGTTGAGTGTGGGAAGGGTTTTCGTCATCCTTCTGAACTCAAGAAACATATGAG

AACCCATACTGGTGAGAAGCCATATCAGTGTCAGTACTGTGCATTCAGATGTGCAGATCAATCAAACCTGAAAACGCACATTAAGTCTAAGCATGGTAGC

AACTTGCCCTATAAATGTGAGCATTGTCCTCAAGCCTTTGGTGATGAGAGAGAGCTTCAGCGCCATCTGGATTTGTTTCAAGGACATAAAACACACCAAT

GTCCTCATTGTGATCATAAGAGCACCAACTCAAGTGACCTTAAGCGGCACATCATATCTGTCCATACCAAGGACTTTCCTCACAAATGTGAAGTCTGTGA

TAAAGGTTTTCATCGTCCTTCAGAGCTTAAAAAACATAGTGATATTCATAAGGGTAGGAAGATTCACCAGTGTAGGCATTGTGACTTTAAAACCTCAGAT

CCATTTATTCTTAGTGGTCATATCCTTTCAGTTCATACTAAAGATCAGTCATTGAAGTGTAAAAGGTGCAAGAGAGGATTCAGACAACAGAATGAGCTGA

AAAAGCACATGAAGACTCATACTGGAAGGAAGATTTACCAATGTGAATATTGTGAATACAGCACCACAGATGCATCTGGATTCAAACGACATGTGATTTC

AATACATACGAAAGACTATCCACACAGGTGTGAATTCTGCAAAAAGGGATTCCGAAGACCATCAGAAAAAAAGCAGCATATAATGAGGCACCACAAGGAG

ACTCTTATGTAGTAAGATCGAAATAAGGAAAGATGTCATTTACAAAATAAAATATACTATTTGGGAGGAAAATCTCACTGTTTGATCTGGTTTCAAAGCT

TGATATTAAATCATAAATTTACATTCTTTGTATTAAAGATCTTGAAATATTTGGACTAGAAAGGCAGTCTCATAGCCCTTTGAAAATTATCTAAAGAATT

TAAGGAGTACCATAGGACGGTTGCAGAGGAACTTAACTGTCATTAACAGTATTATATGCATAACTAAACTACAGAGGGGGAAAGTTAAGACACCTTATTT

GATTGGTTACACTAGAGATAAGTGTTTCTGGAAGGAGAATACATAATTGATTTAGAAATGCTTTGCTGTAGCAAGCAGCCTCACTTTTATGCAATTTTAG

AAATAGGGTGGGGAAAGAAAATGCAGTCATCCATCAGTCACTTAGTCATTGAACCTTTTATATTGTACCTGGACATTGGATTCCAGAAACAGCAAATGTT

TTGTGTATTTGTTACAAGGAATCTCACTCTGGTAAAACAAGTTACATTGATTCAGTCCTAGTTTTAAAAAGGCAGAACTTCAGAGTTGTTGATATTTTAT

CACAGGACATGAAGTTTAAGACATAGCATTCTGTGCTGAAACCTGAAGGGAAATATAAGAAATAAAGAGTTCCAGTTTTGATGTTCAAGTAGATTCAGTA

TGGCATATATGATAAAAGTGTTTGAGTCAAATGTGGCTTTCTAAAATGGATGCAAGTATGTTAAAAAGTCAACACTATGTTTCTTATAATCTGAATGTTA

AATTGAGAGAACAGTTTTCTTAAATATGAAAATATTTAGAATTTTTAGGGCATTTTTAGTAAGTATGACTCTTCAAGTCTTACTTGCTCTAATGTTTAAA

GGTGCAATTTTATGCCATTATTGAAAATTTTGATTTTTAAAATCTATATACCATATTCTTAACATAAATTTTCAATGAGGTGGTATTTATGCAGTATTTA

ACAGAACAATATGCTGCCAATAGAGTTTGGAGGTGGGTATTCAGTTTACAGTGTATAAATTTAAAATATGCATCCCTTAACAACGCTTTGTGTTAGCATG

CTGCAAATCAAAATGGCGCTTAATATTAAAACCTGGTGTAGGGAATTTTAATGAAAATCCTGTTCATAAATGTAATGCATATGATGTGTACTTTTAAGTT

CTAGTCCCCAAATTTAGTTTATATTCAGCTGTTCAGCATAACTAATGTGTAATTTTCCTTCACGCTATATTGTGGCTTTGTGTTTTAAGTAATATTCTCC

TTTCTGTTTTTGCACCAGATAAGAATCTGTTACTTGAAAACAAATTTTTTTATCTTTCTTAACTTCAGAATACTAAATTTGGAAAATCTACTAAACTTGT

GTGTTATGTGGCTGTAAATGATGTACACGCTGTAAAATAAGATTGTTACTGTTACGTGGACTTATTATTTCTAAATGTTACTCATTGAAATGAGCATACA

ATAAAAAGCATTTATTGC
Translation
 MESGGGSLGLHTSDARMAHTMIMQDFV VAGMAGTAHIDGDHIVVSVPEAVLVSDVVTDDGITLDHGLAAEVVHGPDIITETDVVTEGVIVPEAVLEAD

VAIEEDLEEDDGDHILTSELITETVRVPEQVFVADLVSGPDGHLEHVVQDCVSGVDSPTMVSEEVLVTNSDTETVIQAGGGVPGSTVTIKTEEDDDDDVK

STSEDYLMISL LDDVGEKLEHMGNTPLKIASDGSQEDVKEDAFGSEVIKVYIFKAEAEDDVEIG GGTEIVTESEYSSGHSVAGVLDQSRMQREKMVYM

AVKDSSQEQDDIR - UNI32777 - RDERRVSRRYEECQAPG GNTFDSALENRNTTAAQYLQICDSMNTNKVLKQKIKKRRRGETRQWQTA AVIIG

PDGQPLTVYPCHICTKKFKSRGFLKRHMKNHPDHLMRKKYQCTDCDFTTNKKVSFHNHLESHKLINKVDKTHEFTEYTRRYREASPLSSNKLILRDKEPK

MHKCKYCDYETAEQGLLNRHLLAVHSKSFPHVCVECGKGFRHPSELKKHMRTHTGEKPYQCQYCAFRCADQSNLKTHIKSKHGSNLPYKCEHCPQAFGDE

RELQRHLDLFQGHKTHQCPHCDHKSTNSSDLKRHIISVHTKDFPHKCEVCDKGFHRPSELKKHSDIHKGRKIHQCRHCDFKTSDPFILSGHILSVHTKDQ

SLKCKRCKRGFRQQNELKKHMKTHTGRKIYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEFCKKGFRRPSEKKQHIMRHHKETLM
Transcript ENSMUST00000113409
Sequence
GCACTCGGACTCCACCGGCGGCGCAGCCTTGGCTGCGAGTCCGCGGGGTCTCCTAGCACGAACCCAGCGCGGGCTCCACGGTCGGCGTGGCGCGCGCGTG

CGCGCGCTCCCCCTTTGGCCCCCTACCCTGCAGCAAGGGTAGCGTGACGTAATGCAACCTCAGCATGTAGGAGCGCTATAAAGCGGGACGAGGCGGCGCG

CCTCGCAGACGCAGAGTAGCTCGTGATTGGCTCGGGCTGCGGAACCTCGGAATCCCGAACGAACGCCAGGACCTTCCAGGTCCACGGCTGCCGCCCCCCG

CGGCAGTTGAGAGCGCGGCCTCCGACTGCCTGGCGGCGGGGAAGGCGGTGGCGGTTGCAGCCCCGCGGAGGCGGTGACAG ATACATGTGAATGAGCTTT

GCTAAGGATGGAGTCAGGTGGTGGAAGTCTTGGATTGCACACTTCAGATGCTAGAATGGCTCATACCATGATTATGCAGGATTTTG TGGCTGGAATGGC

TGGTACTGCACATATCGATGGAGACCATATTGTAGTTTCAGTTCCTGAAGCTGTATTAGTTTCTGATGTTGTCACAGATGATGGGATAACTCTCGATCAT

GGCCTTGCAGCTGAAGTTGTCCATGGGCCTGATATTATTACAGAGACTGATGTGGTAACAGAAGGGGTGATTGTTCCTGAAGCTGTGCTTGAAGCCGATG

TTGCCATTGAAGAAGATTTGGAAGAAGATGATGGAGATCATATCTTAACTTCTGAGCTTATTACAGAAACCGTTAGGGTACCTGAGCAGGTTTTTGTGGC

TGATCTTGTTTCTGGTCCTGATGGACATTTGGAACATGTGGTCCAAGATTGTGTTTCAGGTGTGGACTCTCCCACAATGGTGTCAGAAGAAGTTCTTGTA

ACTAATTCAGATACAGAAACTGTGATTCAAGCAGGTGGTGGTGTTCCTGGTTCTACTGTTACCATAAAAACGGAAGAAGATGATGATGATGATGTCAAGA

GCACTTCCGAAGACTACTTAATGATATCTT TGGATGATGTGGGAGAGAAGTTAGAGCATATGGGGAACACGCCATTGAAAATCGCTAGCGATGGTTCAC

AAGAAGATGTTAAAGAAGATGCATTTGGTTCAGAAGTGATAAAAGTATATATCTTTAAAGCAGAGGCTGAAGATGATGTTGAAATAG GTGGGACAGAAA

TTGTCACAGAGAGTGAATACAGCAGTGGCCATTCTGTAGCTGGAGTGCTTGACCAGAGCCGAATGCAGCGAGAGAAAATGGTTTACATGGCAGTGAAAGA

TTCTTCCCAGGAACAGGATGATATCA - UNI32777 - GTAATGCTGATATATCAAATGAACTGTGCATGGAAGTCATTATAGGGGAAGAGGAAGGAA

CTCCCCTTGAAATTCCGCTTCAGGACTGTGATGTTAATAAAACAGGTTCCCCTGTTCTCTCTCCTGCATCATATG ATGAGAGACGAGTTTCTCGAAGGT

ATGAAGAATGTCAAGCACCAG GAAACACTTTTGACTCAGCATTAGAAAACAGAAACACTACAGCAGCACAGTACCTTCAAATTTGTGATAGCATGAACA

CAAATAAAGTTCTTAAACAAAAAATCAAGAAGAGGAGAAGGGGAGAAACAAGGCAGTGGCAAACAG CTGTTATAATAGGTCCTGATGGACAGCCCTTGA

CAGTATACCCTTGCCATATTTGCACAAAAAAGTTTAAATCCAGGGGATTCTTAAAAAGACACATGAAGAATCATCCCGATCATTTGATGAGAAAGAAGTA

CCAGTGTACAGATTGTGATTTCACAACTAACAAGAAAGTGAGTTTCCATAACCACTTAGAAAGCCATAAGCTCATAAACAAGGTTGATAAAACCCATGAA

TTTACAGAATACACTCGAAGATACAGAGAAGCTAGTCCACTGAGTTCAAATAAACTCATTTTAAGAGACAAGGAACCGAAGATGCACAAGTGCAAGTACT

GTGATTACGAAACTGCCGAACAAGGACTGTTAAATAGACATTTGCTGGCTGTTCATAGCAAGAGTTTTCCTCATGTTTGTGTTGAGTGTGGGAAGGGTTT

TCGTCATCCTTCTGAACTCAAGAAACATATGAGAACCCATACTGGTGAGAAGCCATATCAGTGTCAGTACTGTGCATTCAGATGTGCAGATCAATCAAAC

CTGAAAACGCACATTAAGTCTAAGCATGGTAGCAACTTGCCCTATAAATGTGAGCATTGTCCTCAAGCCTTTGGTGATGAGAGAGAGCTTCAGCGCCATC

TGGATTTGTTTCAAGGACATAAAACACACCAATGTCCTCATTGTGATCATAAGAGCACCAACTCAAGTGACCTTAAGCGGCACATCATATCTGTCCATAC

CAAGGACTTTCCTCACAAATGTGAAGTCTGTGATAAAGGTTTTCATCGTCCTTCAGAGCTTAAAAAACATAGTGATATTCATAAGGGTAGGAAGATTCAC

CAGTGTAGGCATTGTGACTTTAAAACCTCAGATCCATTTATTCTTAGTGGTCATATCCTTTCAGTTCATACTAAAGATCAGTCATTGAAGTGTAAAAGGT

GCAAGAGAGGATTCAGACAACAGAATGAGCTGAAAAAGCACATGAAGACTCATACTGGAAGGAAGATTTACCAATGTGAATATTGTGAATACAGCACCAC

AGATGCATCTGGATTCAAACGACATGTGATTTCAATACATACGAAAGACTATCCACACAGGTGTGAATTCTGCAAAAAGGGATTCCGAAGACCATCAGAA

AAAAAGCAGCATATAATGAGGCACCACAAGGAGACTCTTATGTAGTAAGATCGAAATAAGGAAAGATGTCATTTACAAAATAAAATATACTATTTGGGAG

GAAAATCTCACTGTTTGATCTGGTTTCAAAGCTTGATATTAAATCATAAATTTACATTCTTTGTATTAAAGATCTTGAAATATTTGGACTAGAAAGGCAG

TCTCATAGCCCTTTGAAAATTATCTAAAGAATTTAAGGAGTACCATAGGACGGTTGCAGAGGAACTTAACTGTCATTAACAGTATTATATGCATAACTAA

ACTACAGAGGGGGAAAGTTAAGACACCTTATTTGATTGGTTACACTAGAGATAAGTGTTTCTGGAAGGAGAATACATAATTGATTTAGAAATGCTTTGCT

GTAGCAAGCAGCCTCACTTTTATGCAATTTTAGAAATAGGGTGGGGAAAGAAAATGCAGTCATCCATCAGTCACTTAGTCATTGAACCTTTTATATTGTA

CCTGGACATTGGATTCCAGAAACAGCAAATGTTTTGTGTATTTGTTACAAGGAATCTCACTCTGGTAAAACAAGTTACATTGATTCAGTCCTAGTTTTAA

AAAGGCAGAACTTCAGAGTTGTTGATATTTTATCACAGGACATGAAGTTTAAGACATAGCATTCTGTGCTGAAACCTGAAGGGAAATATAAGAAATAAAG

AGTTCCAGTTTTGATGTTCAAGTAGATTCAGTATGGCATATATGATAAAAGTGTTTGAGTCAAATGTGGCTTTCTAAAATGGATGCAAGTATGTTAAAAA

GTCAACACTATGTTTCTTATAATCTGAATGTTAAATTGAGAGAACAGTTTTCTTAAATATGAAAATATTTAGAATTTTTAGGGCATTTTTAGTAAGTATG

ACTCTTCAAGTCTTACTTGCTCTAATGTTTAAAGGTGCAATTTTATGCCATTATTGAAAATTTTGATTTTTAAAATCTATATACCATATTCTTAACATAA

ATTTTCAATGAGGTGGTATTTATGCAGTATTTAACAGAACAATATGCTGCCAATAGAGTTTGGAGGTGGGTATTCAGTTTACAGTGTATAAATTTAAAAT

ATGCATCCCTTAACAACGCTTTGTGTTAGCATGCTGCAAATCAAAATGGCGCTTAATATTAAAACCTGGTGTAGGGAATTTTAATGAAAATCCTGTTCAT

AAATGTAATGCATATGATGTGTACTTTTAAGTTCTAGTCCCCAAATTTAGTTTATATTCAGCTGTTCAGCATAACTAATGTGTAATTTTCCTTCACGCTA

TATTGTGGCTTTGTGTTTTAAGTAATATTCTCCTTTCTGTTTTTGCACCAGATAAGAATCTGTTACTTGAAAACAAATTTTTTTATCTTTCTTAACTTCA

GAATACTAAATTTGGAAAATCTACTAAACTTGTGTGTTATGTGGCTGTAAATGATGTACACGCTGTAAAATAAGATTGTTACTGTTACGTGGACTTATTA

TTTCTAAATGTTACTCATTGAAATGAGCATACAATAAAAAGCATTTATTGC
Translation
 MESGGGSLGLHTSDARMAHTMIMQDFV VAGMAGTAHIDGDHIVVSVPEAVLVSDVVTDDGITLDHGLAAEVVHGPDIITETDVVTEGVIVPEAVLEAD

VAIEEDLEEDDGDHILTSELITETVRVPEQVFVADLVSGPDGHLEHVVQDCVSGVDSPTMVSEEVLVTNSDTETVIQAGGGVPGSTVTIKTEEDDDDDVK

STSEDYLMISL LDDVGEKLEHMGNTPLKIASDGSQEDVKEDAFGSEVIKVYIFKAEAEDDVEIG GGTEIVTESEYSSGHSVAGVLDQSRMQREKMVYM

AVKDSSQEQDDIS - UNI32777 - SNADISNELCMEVIIGEEEGTPLEIPLQDCDVNKTGSPVLSPASYD DERRVSRRYEECQAPG GNTFDSALE

NRNTTAAQYLQICDSMNTNKVLKQKIKKRRRGETRQWQTA AVIIGPDGQPLTVYPCHICTKKFKSRGFLKRHMKNHPDHLMRKKYQCTDCDFTTNKKVS

FHNHLESHKLINKVDKTHEFTEYTRRYREASPLSSNKLILRDKEPKMHKCKYCDYETAEQGLLNRHLLAVHSKSFPHVCVECGKGFRHPSELKKHMRTHT

GEKPYQCQYCAFRCADQSNLKTHIKSKHGSNLPYKCEHCPQAFGDERELQRHLDLFQGHKTHQCPHCDHKSTNSSDLKRHIISVHTKDFPHKCEVCDKGF

HRPSELKKHSDIHKGRKIHQCRHCDFKTSDPFILSGHILSVHTKDQSLKCKRCKRGFRQQNELKKHMKTHTGRKIYQCEYCEYSTTDASGFKRHVISIHT

KDYPHRCEFCKKGFRRPSEKKQHIMRHHKETLM

For any suggestions or comments, please send an email to unitrap@crg.es