Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025531 (Chm)
Chromosomal location
Chr X: 110154201 - 110299124 (-)
Description
choroidermia Gene [Source:MGI (curated);Acc:Chm-001]
RefSeq_dna
NM_018818 
RefSeq_peptide
NP_061288.2 
UniGene
Mm.412374 Mm.257316 
MGI
MGI:892979 
Uniprot/SWISSPROT
Q9QXG2 
Uniprot/SPTREMBL
Q3UR39 Q9CS14 A2AD03 Q8CBI2 
Human Ortholog
ENSG00000188419 (CHM)
Omim 303100 - CHOROIDEREMIA  
UniTrap UNI474
Vector Insertion
Chr X: 110273180 - 110299049
Public Clones (sanger) DB0164 (sanger) XH346 (baygenomics) XG523 (baygenomics) P013A10 (ggtc)
IST11647G1 (tigm)
Private Clones OST64217 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6699
Vector Insertion
Chr X: 110254396 - 110273112
Public Clones BGC481 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3695
Vector Insertion
Chr X: 110161106 - 110166670
Public Clones AE0688 (sanger) AE0676 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113388
Sequence
AGTCACATGACACGTTTCCTGTCAAGATGGCGGATAATCTCCCTTCGGACTTTGATGTGATCGTAATAGGGACGG - UNI474 - GTCTGCCTGAATC

CATCATTGCAGCTGCATGTTCAAGGAGTGGCCAGAGGGTTCTGCATGTTGATTC - UNI6699 - AAGAAGCTACTATGGAGGAAACTGGGCCAGTTT

CAGCTTTTCAGGACTGTTGTCCTGGCTAAAGGAATACCAG GAAAATAGTGATGTTGTGACTGAAAATTCAATGTGGCAAGAACAGATACTTGAAAACGA

AGAAGCTATTCTTCTTAGTAGCAAGGACAAAACAATTCAACATGTAGAAGTATTTTGTTATGCCAG TCAGGATTTGCACAAAGATGTTGAAGAAGCTGG

TGCACTGCAGAAAAATCCTGCTTCAGTGATGTCCGCACAGGCCACAGAGGCCGCAGAGGCTGCAGAGGCCGCAGAGGCTGCAGAGGCCACAGAGGCTGCA

GAGGCCGCTTGCCTTCCTACTGCAGAGGAGTCCTTAAGCACGAGGAGCTGTGAACTACCTGCAGAACAAAGTCAGTGCACGGGGCCAGAGAGTTCACCAC

AAGTAAATGATGCTGAAGTAGGAGAGAAAGAAACTCAGAGTGATGCAAAAAGTTCAACAGAACAATCAAGTGAAATTTTGCCTAAAGTACAAGACAACAC

AGAGACACCAAAGAGAAATGTAATTACTTACTCACAGATTATTAAAGAAGGCCGAAGATTTAACATTGATTTAGTATCAAAA GTCCCCTGTTCCAGAGC

AGATGTCTTCAATAGCAAACAACTTACTATGGTAGAAAAGCGAATGCTTATGAAATTTCTTACATTTTGTGTGGAATATGAAGACCATCCCGATGAGTAC

AAAG CATACGAGGAAACTACATTTTCTGAATACTTAAAAACTCAAAAATTAACCCCCAACCTACAATATTTTGTCCTGCACTCAATTGCAATGACATCA

GAGACAACAAGCAGTACTGTAGATGGTCTCAAAGCTACTAAAAAGTTTCTTCAGTGTCTTGGGCGGTATGGCAACACTCCATTTCTGTTTCCTTTATATG

GCCAAGGAGAACTTCCACAGTGTTTTTGCAG AATGTGTGCTGTGTTTGGTGGAATCTATTGTCTTCGCCATTCAGTACAGTGCCTTGTAGTGGACAAAG

AATCCAGAAA ATGTAAAGCAATTGTAGATCAGTTTGGTCAAAGGATAATCTCTAAACATTTCGTTATTGAAGACAGTTACCTTTCTGAGAATACATGTT

CCGGTGTACAGTACAG GCAAATTTCCAGGGCAGTCCTGATTACAGATGGATCAGTACTAAAACCCGATTCTGATCAACAG GTCTCCATTTTGACAGTG

CCAGCAGAAGAGTCAGGAAGTTTTGCTGTTCGAGTCATTGAGTTATGCTCTTCAACAATGACATGCATGAAAGGCACAT ACTTGGTACATTTGACTTGC

ATGTCTTCTAAAACAGCAAGAGAAGATTTAGAACGAGTAGTCCAGAAATTGTTTACTCCATATACAGAAATCGAAGCAG - UNI3695 - AAAATGAA

CAGGTTGAAAAGCCAAGAATTCTATGGGCACTCTACTTCAATATGAGAGACTCTTCGGATATCAGCAGAGATTGTTATAATGATTTACCGTCCAATGTCT

ATGTGTGCTCTGGCCCTGACTGTAATCTAGGAAATGATAATGCAGTCCAACAG GCGGAAACAGTTTTCCAGAAAATCTGCCCAAATGAAGACTTCTGTC

CAGCCCCACCAAATCCTGAAGATATTATTCTTGATGGAGACAGCTCACAACAAGAAGTTTCAGAATCCAGTGTCATACCAGAAACCAACTCAGAAACTCC

CAAGGAAAGTACAGTCCTAGGAGACTCAGAAGAGCCCTCTGAATAGTGGATGTGCATCAGACATAACATTCTATTTGGAAATTCCTGTCGCCTTCACAGT

CTTCTTGATAGAAGGAATATTTGAAATCTTTCAAAAAGCAACAACCAATTTATTAGGAAAAATTAGGAGAAACAGGTTCCAGAAATCCAAAAAGGAATTT

TTTCAACAAGGGCATTTCCAGAAACATAAAACACTTATAAAGCACATTAACTTACCTGTTTTAACATACCAAACCTGTGAGATTAGCAGGTGAAAAATAT

GAAAGGACTGATTCCCAGAAATGTAGTTATGATGGGAAAGGGGTCCTATGCTTCGTTAACAATTATGTGGTGTTCACAGAAATTTGTTCGCCAATTGTGA

TCTTTTTGTTGTTGTTGTTGTTGAAAGCCACATCTGGAGAGTCAGCTCACATACTTATTTTGGTTATTTGAATTATATTTTCAATCTGAGCATGATATAA

CAGATAAAAGCATGTGTAAATACGGTAGAATAAAGCTAAACTATCATGAACTGGCCAGGAGCCTATATTTGGAGTAAAAGTTGGTTTTATTTCCTATGTT

AAAAGCTGAATATGTTAATACTAAGGTGTTTAGACATTTTGCTAATTTTAATTTCTTAGTAATTAGTGATTTGTATATAAATCACATACACAATTGGCCA

AACTTCAAAGATTAAGAAATAGAAGAATACAAGCAAACATTTGATAGGATGATTCTACTGAGTCAACGGAAGCACTAAGTCCTTATCCACAGAACTAATT

TCATCATAGCTGTGTTACTCAAAATATTAGGCAAATTGTTAAACTTATCTTCAGTTTCTCCAGATATGAAGTGAAACATGCCTCCTATAACAGAGCAGTC

TTGAAGATCAATGCAGCACTAACATTAGAATGGTTCTTCTGGACATTGATCTGTGGAAAAATATCAAACCAACCTCATGATCACAGTGTTATATTTATTG

CAGTAAATTTTTAATGCCAGTCTGTTTCCTAAACTCATTAATAACAGGTGGAATGGTAGTTCTTGAAGTCTTAGGAATACTTTATAAATTAACGTTCCTC

TTCTGGCAACAAAACCATCAAGACCTGAACAGAGTGTAGCAATTAATAACCTGTAATATACATTTTACATGAGAAAAATGAGGGCTATCCATTGACAGAA

AACCTATTTGCAATGCCTACATTTAAATGTCTCTAAGCTCTGATGGTCTACTTTCTTGAGCAATAGTTTAGACCTAGAACTGCCTATAAATAAATAAACA

ATAAATAAACGCAATGCTTCCTGTCAGGGAGCCATGGCTCCAAGGAAAAGCACAGAATTCTCCATGTGCAGCTGCTTCCCTAACCTGGCCAGGTTTCAGC

GATGTTAAAGCTCCCAGCACAGATTCATAAGAAATGTAAAAATCCAAGGAATGTAGCTCTTGCTGACCCTTGAAGAAGGAGTTGGATTGAGAAAATGGGA

AAAATTTCCCAGACTTCCAGGCTGTTCCTCTCAGGTTGCCTGTACCTCCCGCTGTACAGCTCTCTCCTCTGGGGTATCCAATCCTTTTTATAATGTCACA

CAAATCAGGGACAGAATCACTTTATAACCTACTTTGTCACAAAGCTTCAGCTCTTATGTCAGCTGTTGTTTCCTGAAGCCCACCTAGGGCATGCACTAAA

TGCCAAGTACGCTCCTGTAATGCACCAGGTACTGGCCCTGCCTCTCCATACCAGCAATATGAAAGTTTCTCTTGGATGGGGACGTTAAGTTGGAATACAA

TCACAGTTATGTCACACCAGTAAAAGTGTTATACTTTGTTATAATCTTAGAGTTAAGGCCTCCTAAATGTAGAATGCACATTTATCTAAGGAGACTATTA

AGCTAGATAGGGTTAGAATAATTAGAAGAACTAGACACCTTTGGACACTGCAGCTCTGTACATTGTAGAACAACACAGAAACTATTTTTTATTTCATGGC

CCAGCGTACACAATATCTTTTTTTCATCCTTTTGGTGCAATCAGAAAAAAAAAAAAAAAAACTCTCTTCCAGGTCATTTACTGAGTATATTATTAAAATG

CTTAAAGCTCCTGAATATGATTAATAATGACTGAAATACCACAAAATTGTTTTCAAAATTGTAGACAGACCTATTTCTTGTTGCCTCAGAGTGTCATACT

AAACCTTTGAAGAGCATTTTCTTTTGTTTTCTTAATTATTGCTTAATACTTGGTTTTACTGTATTAAGGTCAAAACAATACCAACAACAAACCTTAAGGT

TGTATTATAAAACCTTACAACACAATGTTTGCTGTTTTACACAATGCAAACATTTCAGTAATTTTAAATTTTGAAGTTGCTGGTATCAAAATTTTTTTAT

TTGTTTGTTGAAAGTATTTAAATATGCATGCCTGTTTCTGGAAACGAAAAATGGTATATCATTAAGTGATAAGATCCAATAACTAATCCTATGTTGCTTT

TGTATATTTTTCTAGTTGGTGTGCCTGTCTAAGAAAGCATATATAATAAATGTCAGTTTCTATTTTTATATAATAAAATGGCCATGGGTAACTTCTAGAC

TAGTGGACATTTCTAACATAATATCTATAATTATAATGTTAATTAATAATTATTAACTTCTGGCAAGATTGTTTCTAGAATTATCTGCCCTAGTATTGTT

ATCTAGTTCCTAATAGTAGCAATCATTTAAAGGAATTTAAAAAAACATTTTCTTGCAAATACTTATGTGCTACTGGTATTGAATAATTTGTCTTTTGCTC

AGTAAAAGTTCTTACGTATTTAAAAAGGCATGAGTCTATAATAATTTGCATACTGTAACAGGGAATTTTCAGAGAAAATAAAGACTTTTCAATGCTTT
Translation
MADNLPSDFDVIVIGTG - UNI474 - GLPESIIAAACSRSGQRVLHVDS - UNI6699 - SRSYYGGNWASFSFSGLLSWLKEYQ ENSDVVTEN

SMWQEQILENEEAILLSSKDKTIQHVEVFCYAS SQDLHKDVEEAGALQKNPASVMSAQATEAAEAAEAAEAAEATEAAEAACLPTAEESLSTRSCELPA

EQSQCTGPESSPQVNDAEVGEKETQSDAKSSTEQSSEILPKVQDNTETPKRNVITYSQIIKEGRRFNIDLVSK VPCSRADVFNSKQLTMVEKRMLMKFL

TFCVEYEDHPDEYKA AYEETTFSEYLKTQKLTPNLQYFVLHSIAMTSETTSSTVDGLKATKKFLQCLGRYGNTPFLFPLYGQGELPQCFCR RMCAVFG

GIYCLRHSVQCLVVDKESRK KCKAIVDQFGQRIISKHFVIEDSYLSENTCSGVQYR RQISRAVLITDGSVLKPDSDQQ VSILTVPAEESGSFAVRVI

ELCSSTMTCMKGTY YLVHLTCMSSKTAREDLERVVQKLFTPYTEIEAE - UNI3695 - ENEQVEKPRILWALYFNMRDSSDISRDCYNDLPSNVYV

CSGPDCNLGNDNAVQQ AETVFQKICPNEDFCPAPPNPEDIILDGDSSQQEVSESSVIPETNSETPKESTVLGDSEEPSE
Transcript ENSMUST00000026607
Sequence
AGTCACATGACACGTTTCCTGTCAAGATGGCGGATAATCTCCCTTCGGACTTTGATGTGATCGTAATAGGGACGG - UNI474 - GTCTGCCTGAATC

CATCATTGCAGCTGCATGTTCAAGGAGTGGCCAGAGGGTTCTGCATGTTGATTC - UNI6699 - AAGAAGCTACTATGGAGGAAACTGGGCCAGTTT

CAGCTTTTCAGGACTGTTGTCCTGGCTAAAGGAATACCAG GAAAATAGTGATGTTGTGACTGAAAATTCAATGTGGCAAGAACAGATACTTGAAAACGA

AGAAGCTATTCTTCTTAGTAGCAAGGACAAAACAATTCAACATGTAGAAGTATTTTGTTATGCCAG TCAGGATTTGCACAAAGATGTTGAAGAAGCTGG

TGCACTGCAGAAAAATCCTGCTTCAGTGATGTCCGCACAGGCCACAGAGGCCGCAGAGGCTGCAGAGGCCGCAGAGGCTGCAGAGGCCACAGAGGCTGCA

GAGGCCGCTTGCCTTCCTACTGCAGAGGAGTCCTTAAGCACGAGGAGCTGTGAACTACCTGCAGAACAAAGTCAGTGCACGGGGCCAGAGAGTTCACCAC

AAGTAAATGATGCTGAAGTAGGAGAGAAAGAAACTCAGAGTGATGCAAAAAGTTCAACAGAACAATCAAGTGAAATTTTGCCTAAAGTACAAGACAACAC

AGAGACACCAAAGAGAAATGTAATTACTTACTCACAGATTATTAAAGAAGGCCGAAGATTTAACATTGATTTAGTATCAAAA CTTCTCTATTCTCGGGG

ATTACTAATTGATCTTCTAATCAAATCAAATGTTAGTCGGTATGCAGAGTTTAAAAACATTACGAGGATTCTTGCATTTCGAGAAGGAACTGTGGAACAG

 GTCCCCTGTTCCAGAGCAGATGTCTTCAATAGCAAACAACTTACTATGGTAGAAAAGCGAATGCTTATGAAATTTCTTACATTTTGTGTGGAATATGAA

GACCATCCCGATGAGTACAAAG CATACGAGGAAACTACATTTTCTGAATACTTAAAAACTCAAAAATTAACCCCCAACCTACAATATTTTGTCCTGCAC

TCAATTGCAATGACATCAGAGACAACAAGCAGTACTGTAGATGGTCTCAAAGCTACTAAAAAGTTTCTTCAGTGTCTTGGGCGGTATGGCAACACTCCAT

TTCTGTTTCCTTTATATGGCCAAGGAGAACTTCCACAGTGTTTTTGCAG AATGTGTGCTGTGTTTGGTGGAATCTATTGTCTTCGCCATTCAGTACAGT

GCCTTGTAGTGGACAAAGAATCCAGAAA ATGTAAAGCAATTGTAGATCAGTTTGGTCAAAGGATAATCTCTAAACATTTCGTTATTGAAGACAGTTACC

TTTCTGAGAATACATGTTCCGGTGTACAGTACAG GCAAATTTCCAGGGCAGTCCTGATTACAGATGGATCAGTACTAAAACCCGATTCTGATCAACAG 

GTCTCCATTTTGACAGTGCCAGCAGAAGAGTCAGGAAGTTTTGCTGTTCGAGTCATTGAGTTATGCTCTTCAACAATGACATGCATGAAAGGCACAT AC

TTGGTACATTTGACTTGCATGTCTTCTAAAACAGCAAGAGAAGATTTAGAACGAGTAGTCCAGAAATTGTTTACTCCATATACAGAAATCGAAGCAG - 

UNI3695 - AAAATGAACAGGTTGAAAAGCCAAGAATTCTATGGGCACTCTACTTCAATATGAGAGACTCTTCGGATATCAGCAGAGATTGTTATAATG

ATTTACCGTCCAATGTCTATGTGTGCTCTGGCCCTGACTGTAATCTAGGAAATGATAATGCAGTCCAACAG GCGGAAACAGTTTTCCAGAAAATCTGCC

CAAATGAAGACTTCTGTCCAGCCCCACCAAATCCTGAAGATATTATTCTTGATGGAGACAGCTCACAACAAGAAGTTTCAGAATCCAGTGTCATACCAGA

AACCAACTCAGAAACTCCCAAGGAAAGTACAGTCCTAGGAGACTCAGAAGAGCCCTCTGAATAGTGGATGTGCATCAGACATAACATTCTATTTGGAAAT

TCCTGTCGCCTTCACAGTCTTCTTGATAGAAGGAATATTTGAAATCTTTCAAAAAGCAACAACCAATTTATTAGGAAAAATTAGGAGAAACAGGTTCCAG

AAATCCAAAAAGGAATTTTTTCAACAAGGGCATTTCCAGAAACATAAAACACTTATAAAGCACATTAACTTACCTGTTTTAACATACCAAACCTGTGAGA

TTAGCAGGTGAAAAATATGAAAGGACTGATTCCCAGAAATGTAGTTATGATGGGAAAGGGGTCCTATGCTTCGTTAACAATTATGTGGTGTTCACAGAAA

TTTGTTCGCCAATTGTGATCTTTTTGTTGTTGTTGTTGTTGAAAGCCACATCTGGAGAGTCAGCTCACATACTTATTTTGGTTATTTGAATTATATTTTC

AATCTGAGCATGATATAACAGATAAAAGCATGTGTAAATACGGTAGAATAAAGCTAAACTATCATGAACTGGCCAGGAGCCTATATTTGGAGTAAAAGTT

GGTTTTATTTCCTATGTTAAAAGCTGAATATGTTAATACTAAGGTGTTTAGACATTTTGCTAATTTTAATTTCTTAGTAATTAGTGATTTGTATATAAAT

CACATACACAATTGGCCAAACTTCAAAGATTAAGAAATAGAAGAATACAAGCAAACATTTGATAGGATGATTCTACTGAGTCAACGGAAGCACTAAGTCC

TTATCCACAGAACTAATTTCATCATAGCTGTGTTACTCAAAATATTAGGCAAATTGTTAAACTTATCTTCAGTTTCTCCAGATATGAAGTGAAACATGCC

TCCTATAACAGAGCAGTCTTGAAGATCAATGCAGCACTAACATTAGAATGGTTCTTCTGGACATTGATCTGTGGAAAAATATCAAACCAACCTCATGATC

ACAGTGTTATATTTATTGCAGTAAATTTTTAATGCCAGTCTGTTTCCTAAACTCATTAATAACAGGTGGAATGGTAGTTCTTGAAGTCTTAGGAATACTT

TATAAATTAACGTTCCTCTTCTGGCAACAAAACCATCAAGACCTGAACAGAGTGTAGCAATTAATAACCTGTAATATACATTTTACATGAGAAAAATGAG

GGCTATCCATTGACAGAAAACCTATTTGCAATGCCTACATTTAAATGTCTCTAAGCTCTGATGGTCTACTTTCTTGAGCAATAGTTTAGACCTAGAACTG

CCTATAAATAAATAAACAATAAATAAACGCAATGCTTCCTGTCAGGGAGCCATGGCTCCAAGGAAAAGCACAGAATTCTCCATGTGCAGCTGCTTCCCTA

ACCTGGCCAGGTTTCAGCGATGTTAAAGCTCCCAGCACAGATTCATAAGAAATGTAAAAATCCAAGGAATGTAGCTCTTGCTGACCCTTGAAGAAGGAGT

TGGATTGAGAAAATGGGAAAAATTTCCCAGACTTCCAGGCTGTTCCTCTCAGGTTGCCTGTACCTCCCGCTGTACAGCTCTCTCCTCTGGGGTATCCAAT

CCTTTTTATAATGTCACACAAATCAGGGACAGAATCACTTTATAACCTACTTTGTCACAAAGCTTCAGCTCTTATGTCAGCTGTTGTTTCCTGAAGCCCA

CCTAGGGCATGCACTAAATGCCAAGTACGCTCCTGTAATGCACCAGGTACTGGCCCTGCCTCTCCATACCAGCAATATGAAAGTTTCTCTTGGATGGGGA

CGTTAAGTTGGAATACAATCACAGTTATGTCACACCAGTAAAAGTGTTATACTTTGTTATAATCTTAGAGTTAAGGCCTCCTAAATGTAGAATGCACATT

TATCTAAGGAGACTATTAAGCTAGATAGGGTTAGAATAATTAGAAGAACTAGACACCTTTGGACACTGCAGCTCTGTACATTGTAGAACAACACAGAAAC

TATTTTTTATTTCATGGCCCAGCGTACACAATATCTTTTTTTCATCCTTTTGGTGCAATCAGAAAAAAAAAAAAAAAAACTCTCTTCCAGGTCATTTACT

GAGTATATTATTAAAATGCTTAAAGCTCCTGAATATGATTAATAATGACTGAAATACCACAAAATTGTTTTCAAAATTGTAGACAGACCTATTTCTTGTT

GCCTCAGAGTGTCATACTAAACCTTTGAAGAGCATTTTCTTTTGTTTTCTTAATTATTGCTTAATACTTGGTTTTACTGTATTAAGGTCAAAACAATACC

AACAACAAACCTTAAGGTTGTATTATAAAACCTTACAACACAATGTTTGCTGTTTTACACAATGCAAACATTTCAGTAATTTTAAATTTTGAAGTTGCTG

GTATCAAAATTTTTTTATTTGTTTGTTGAAAGTATTTAAATATGCATGCCTGTTTCTGGAAACGAAAAATGGTATATCATTAAGTGATAAGATCCAATAA

CTAATCCTATGTTGCTTTTGTATATTTTTCTAGTTGGTGTGCCTGTCTAAGAAAGCATATATAATAAATGTCAGTTTCTATTTTTATATAATAAAATGGC

CATGGGTAACTTCTAGACTAGTGGACATTTCTAACATAATATCTATAATTATAATGTTAATTAATAATTATTAACTTCTGGCAAGATTGTTTCTAGAATT

ATCTGCCCTAGTATTGTTATCTAGTTCCTAATAGTAGCAATCATTTAAAGGAATTTAAAAAAACATTTTCTTGCAAATACTTATGTGCTACTGGTATTGA

ATAATTTGTCTTTTGCTCAGTAAAAGTTCTTACGTATTTAAAAAGGCATGAGTCTATAATAATTTGCATACTGTAACAGGGAATTTTCAGAGAAAATAAA

GACTTTTCAATGCTTT
Translation
MADNLPSDFDVIVIGTG - UNI474 - GLPESIIAAACSRSGQRVLHVDS - UNI6699 - SRSYYGGNWASFSFSGLLSWLKEYQ ENSDVVTEN

SMWQEQILENEEAILLSSKDKTIQHVEVFCYAS SQDLHKDVEEAGALQKNPASVMSAQATEAAEAAEAAEAAEATEAAEAACLPTAEESLSTRSCELPA

EQSQCTGPESSPQVNDAEVGEKETQSDAKSSTEQSSEILPKVQDNTETPKRNVITYSQIIKEGRRFNIDLVSK LLYSRGLLIDLLIKSNVSRYAEFKNI

TRILAFREGTVEQ VPCSRADVFNSKQLTMVEKRMLMKFLTFCVEYEDHPDEYKA AYEETTFSEYLKTQKLTPNLQYFVLHSIAMTSETTSSTVDGLKA

TKKFLQCLGRYGNTPFLFPLYGQGELPQCFCR RMCAVFGGIYCLRHSVQCLVVDKESRK KCKAIVDQFGQRIISKHFVIEDSYLSENTCSGVQYR RQ

ISRAVLITDGSVLKPDSDQQ VSILTVPAEESGSFAVRVIELCSSTMTCMKGTY YLVHLTCMSSKTAREDLERVVQKLFTPYTEIEAE - UNI3695 

- ENEQVEKPRILWALYFNMRDSSDISRDCYNDLPSNVYVCSGPDCNLGNDNAVQQ AETVFQKICPNEDFCPAPPNPEDIILDGDSSQQEVSESSVIPE

TNSETPKESTVLGDSEEPSE

For any suggestions or comments, please send an email to unitrap@crg.es